website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 48,216 Antibodies & 21,887 Antigens!

Print Page
100ug
$199.00
In Stock

ILF2 (GST tagged) (Full length) (Human) (100μg)

Description of Target:
Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.
Gene Symbol:
ILF2
Alias Symbols:
RP11-354A16.1; NF45; PRO3063
Molecular Weight:
60
Product Format:
Lyophilized powder
Protein Sequence:
VPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWD
Tag:
GST in N-terminal
Quality Control:
This product was tested on western blot.
Application : Western blot standard.
Observed Molecular Weight: 60
Protein Purity : 90%
Expression system : Bacteria
Reconstitution and Storage:
Already in solution (1mg/ml). For longer periods of storage, store at -20°C. Avoid repeat freeze and thaw cycles.
Key Reference:
N/A
Datasheets / Downloads:
AEP10107