GCLM Protein (AEP10054)

Catalog No: AEP10054

Size:100ug

Gel Concentration: 12%

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Lyophilized powder
• Application: WB
• Reconstitution and Storage: Reconstitute with distilled water. For longer periods of storage, store at -20C. Avoid repeat freeze and thaw cycles.
• Protein Sequence: MQAHELFRYFRMPELVDFRQYVRTLPTNTLMGFGAFAALTTFWYATRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRC
• Tag: GST in N-terminal
• Quality Control: This product was tested on western blot.
  Application : Western blot standard.
  Observed Molecular Weight: 60
  Protein Purity : 90%
  Expression system : Bacteria

Target Info

• Gene Symbol: GCLM
• Alias Symbols: GLCLR
• NCBI Gene Id: 2730
• Protein Name: Glutamate--cysteine ligase regulatory subunit
• Description of Target: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.
• Uniprot ID: P48507
• Protein Accession #: NP_002052
• Nucleotide Accession #: NM_002061
• Molecular Weight: 60
• Protein Interactions: UBC; NAGK; GLRX3; GNAI2; GCLC; STOX1; IRF7; CALM1; SORD; CUL3;