Catalog No: AEP10002
Size:100ug
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-FABP7 (AEP10002) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human |
Product Format | Lyophilized powder |
Application | WB |
Reconstitution and Storage | Reconstitute with distilled water. For longer periods of storage, store at -20C. Avoid repeat freeze and thaw cycles. |
Protein Sequence | MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA |
Tag | GST |
Gene Symbol | FABP7 |
---|---|
Alias Symbols | MRG, BLBP, FABPB, B-FABP |
NCBI Gene Id | 2173 |
Protein Name | Fatty acid-binding protein, brain |
Description of Target | The protein encoded by this gene is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism. |
Uniprot ID | O15540 |
Protein Accession # | NP_001437 |
Nucleotide Accession # | NM_001446 |
Protein Size (# AA) | 132 |
Molecular Weight | 15kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review
We found other products you might like!