- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-BMP7 (OOPA00051) antibody |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
Clonality | Monoclonal |
Host | Nicotiana benthamiana. |
Additional Information | Solubility: Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/ul. |
:: | Product Introduction: The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily. BMPs were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. Based on its expression early in embryogenesis, the BMP encoded by this gene has a proposed role in early development. In addition, the fact that this BMP is closely related to BMP5 and BMP7 has lead to speculation of possible bone inductive activity. Product Description: Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus. The BMP-7 is purified by proprietary chromatographic techniques. |
Reconstitution and Storage | Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution BMP 7 Human should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Peptide Sequence | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH. |
Formulation | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. |
Purity | Greater than 97.0% as determined by SDS-PAGE. |
Biological Activity | The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg. |
Gene Symbol | BMP7 |
---|---|
Gene Full Name | Bone morphogenetic protein 7 |
Alias Symbols | OP-1 |
NCBI Gene Id | 655 |
Protein Name | Bone morphogenetic protein 7 |
Uniprot ID | P18075 |
Protein Accession # | NP_001710.1 |
Nucleotide Accession # | NM_001719.2 |
Protein Size (# AA) | Recombinant |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "BMP7 Antibody (OOPA00051)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "BMP7 Antibody (OOPA00051)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "BMP7 Antibody (OOPA00051)" provided in?
This item is provided in "Sterile Filtered White lyophilized (freeze-dried) powder.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "BMP7 Antibody (OOPA00051)"?
This target may also be called "OP-1" in publications.
-
What is the shipping cost for "BMP7 Antibody (OOPA00051)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "BMP7 Antibody (OOPA00051)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "BMP7 Antibody (OOPA00051)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "BMP7 Antibody (OOPA00051)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BMP7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BMP7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BMP7"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BMP7"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BMP7"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BMP7"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.