website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ZNF341 antibody - middle region (ARP30014_P050)

  • Catalog#: ARP30014_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP30014_P050-FITC Conjugated

    ARP30014_P050-HRP Conjugated

    ARP30014_P050-Biotin Conjugated

    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    ZNF341
    NCBI Gene Id:
    84905
    Official Gene Full Name:
    Zinc finger protein 341
    Protein Name:
    Zinc finger protein 341
    Swissprot Id:
    Q9BYN7
    Protein Accession #:
    NP_116208
    Nucleotide Accession #:
    NM_032819
    Description of Target:
    The ZNF341 gene is located on chromosome 20.
    Protein Size (# AA):
    847
    Molecular Weight:
    92kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    IHC, WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express ZNF341.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express ZNF341.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the middle region of human ZNF341
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
    Predicted Homology Based on Immunogen Sequence:
    Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 86%
    Complete computational species homology data:
    Anti-ZNF341 (ARP30014_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    CENPP; KLHL38; WDYHV1; MAGEB4; CSTF2; ARNT2; PRPF40A;
    Blocking Peptide:
    For anti-ZNF341 (ARP30014_P050) antibody is Catalog # AAP30014 (Previous Catalog # AAPH00114)
    Datasheets / Downloads:
    Printable datasheet for anti-ZNF341 (ARP30014_P050) antibody
    Target Reference:
    Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45

    Product Protocols: ZNF341 antibody tested with Human Hepg2 Cells (ARP30014_P050)

    Aviva Systems Biology is the original manufacturer of this ZNF341 antibody (ARP30014_P050)

    Click here to view the ZNF341 antibody Western Blot Protocol

    Product Datasheet Link: ZNF341 antibody (ARP30014_P050)

    WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: HepG2

    Western Blot image:


    Description of Target: The ZNF341 gene is located on chromosome 20.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s ZNF341 antibody (ARP30014_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

    Product Protocols: ZNF341 antibody tested by IHC with human intestine (ARP30014)

    Aviva Systems Biology is the original manufacturer of this ZNF341 antibody.

    Click here to view the ZNF341 antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: ZNF341 antibody (ARP30014)

    IHC Information:

    Rabbit Anti-ZNF341 Antibody
    Catalog Number: ARP30014
    Paraffin Embedded Tissue: Human Intestine
    Cellular Data: Epithelial cells of intestinal villas
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

     
    X
    Ask a Question