website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Zbtb37 antibody - middle region (ARP30048_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30048_P050-FITC Conjugated

ARP30048_P050-HRP Conjugated

ARP30048_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Zinc finger and BTB domain containing 37
Protein Name:
Protein Zbtb37 Ensembl ENSMUSP00000125253 Ensembl ENSMUSP00000125417 Ensembl ENSMUSP00000131576 Ensembl ENSMUSP00000134769 Ensembl ENSMUSP00000134753
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-109482 from Santa Cruz Biotechnology.
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Zbtb37.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Zbtb37.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-Zbtb37 (ARP30048_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Zbtb37 (ARP30048_P050) antibody is Catalog # AAP30048
Datasheets / Downloads:
Printable datasheet for anti-Zbtb37 (ARP30048_P050) antibody
Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...