SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP74133_P050
Price: $0.00
SKU
ARP74133_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-PITX3 (ARP74133_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human PITX3
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: SLPGGSPEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIA
Concentration0.5 mg/ml
Blocking PeptideFor anti-PITX3 (ARP74133_P050) antibody is Catalog # AAP74133
Gene SymbolPITX3
Alias SymbolsASMD, ASOD, PTX3, ASGD1, CTPP4, CTRCT11
NCBI Gene Id5309
Description of TargetThis gene encodes a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. Members of this family act as transcription factors. This protein is involved in lens formation during eye development. Mutations of this gene have been associated with anterior segment mesenchymal dysgenesis and congenital cataracts.
Uniprot IDO75364
Protein Accession #NP_005020
Protein Size (# AA)302
Molecular Weight33kDa
Protein InteractionsPARK7; MTA1; SFPQ; NONO;
  1. What is the species homology for "PITX3 Antibody - N-terminal region (ARP74133_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "PITX3 Antibody - N-terminal region (ARP74133_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PITX3 Antibody - N-terminal region (ARP74133_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PITX3 Antibody - N-terminal region (ARP74133_P050)"?

    This target may also be called "ASMD, ASOD, PTX3, ASGD1, CTPP4, CTRCT11" in publications.

  5. What is the shipping cost for "PITX3 Antibody - N-terminal region (ARP74133_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PITX3 Antibody - N-terminal region (ARP74133_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PITX3 Antibody - N-terminal region (ARP74133_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "33kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PITX3 Antibody - N-terminal region (ARP74133_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PITX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PITX3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PITX3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PITX3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PITX3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PITX3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PITX3 Antibody - N-terminal region (ARP74133_P050)
Your Rating
We found other products you might like!