SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP75592_P050
Price: $0.00
SKU
ARP75592_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

CHMP3 Antibody - N-terminal region (ARP75592_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for ARP75592_P050
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human CHMP3
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKD
Concentration0.5 mg/ml
Blocking PeptideCatalog # AAP75592
ReferenceN/A
Gene SymbolCHMP3
Alias SymbolsNEDF, VPS24, CGI-149
NCBI Gene Id51652
Description of TargetThis gene encodes a protein that sorts transmembrane proteins into lysosomes/vacuoles via the multivesicular body (MVB) pathway. This protein, along with other soluble coiled-coil containing proteins, forms part of the ESCRT-III protein complex that binds to the endosomal membrane and recruits additional cofactors for protein sorting into the MVB. This protein may also co-immunoprecipitate with a member of the IFG-binding protein superfamily. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream ring finger protein 103 (RNF103) gene.
Uniprot IDQ9Y3E7-4
Protein Size (# AA)182
Molecular Weight20kDa
Protein InteractionsSTAMBP; SMAD5; SMAD1; ATP6V1B1; APP; UBD; CHMP4B; CHMP3; CHMP2A; CHMP2B; TNPO3; RAB11A; CHMP4A; VAV2; UBC; VTA1; VPS4A; IGFBP7;
  1. What is the species homology for "CHMP3 Antibody - N-terminal region (ARP75592_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CHMP3 Antibody - N-terminal region (ARP75592_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CHMP3 Antibody - N-terminal region (ARP75592_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CHMP3 Antibody - N-terminal region (ARP75592_P050)"?

    This target may also be called "NEDF, VPS24, CGI-149" in publications.

  5. What is the shipping cost for "CHMP3 Antibody - N-terminal region (ARP75592_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CHMP3 Antibody - N-terminal region (ARP75592_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CHMP3 Antibody - N-terminal region (ARP75592_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "20kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CHMP3 Antibody - N-terminal region (ARP75592_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CHMP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CHMP3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CHMP3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CHMP3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CHMP3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CHMP3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CHMP3 Antibody - N-terminal region (ARP75592_P050)
Your Rating
We found other products you might like!