- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for DNA-PK Antibody (Phospho-Ser2056) (OAAF07550) |
---|
Predicted Species Reactivity | Human|Mouse |
---|---|
Clonality | Polyclonal |
Host | Rabbit |
Application | Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin |
Additional Information | Modification Sites: Human:S2056 Mouse:S2053 |
Reconstitution and Storage | -20°C |
Immunogen | The antiserum was produced against synthesized peptide derived from human DNA-PK around the phosphorylation site of Ser2056. |
Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
Peptide Sequence | Synthetic peptide located within the following region: PSYMSSLSYLADSTLSEEMSQFDFSTGVQSYSYSSQDPRPATGRFRRREQ |
Concentration | 1mg/ml |
Specificity | DNA-PK (Phospho-Ser2056) Antibody detects endogenous levels of DNA-PK only when phosphorylated at Ser2056. |
Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
Application Info | IHC: 1:50~1:100 ELISA: 1:10000 |
Gene Symbol | PRKDC |
---|---|
Gene Full Name | protein kinase, DNA-activated, catalytic subunit |
Alias Symbols | DNA-dependent protein kinase catalytic subunit;DNAPK;DNA-PK catalytic subunit;DNAPKc;DNA-PKC;DNA-PKcs;DNPK1;hyper-radiosensitivity of murine scid mutation, complementing 1;HYRC;HYRC1;IMD26;p350;p460;protein kinase, DNA-activated, catalytic polypeptide;XRCC7. |
NCBI Gene Id | 5591 |
Protein Name | DNA-dependent protein kinase catalytic subunit |
Description of Target | Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D. Contributes to the determination of the circadian period length by antagonizing phosphorylation of CRY1 'Ser-588' and increasing CRY1 protein stability, most likely through an indirect mechanism. Interacts with CRY1 and CRY2; negatively regulates CRY1 phosphorylation. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway. |
Uniprot ID | P78527 |
Molecular Weight | 469 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".
-
How long will it take to receive "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)"?
This target may also be called "DNA-dependent protein kinase catalytic subunit;DNAPK;DNA-PK catalytic subunit;DNAPKc;DNA-PKC;DNA-PKcs;DNPK1;hyper-radiosensitivity of murine scid mutation, complementing 1;HYRC;HYRC1;IMD26;p350;p460;protein kinase, DNA-activated, catalytic polypeptide;XRCC7." in publications.
-
What is the shipping cost for "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "469 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "PRKDC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "PRKDC"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "PRKDC"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "PRKDC"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "PRKDC"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "PRKDC"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.