DNA-PK Antibody (Phospho-Ser2056) (OAAF07550)

Catalog No: OAAF07550 (Formerly GWB-ASB415)

Size:100 ug

Immunohistochemistry analysis of paraffin-embedded human breast carcinoma, using DNA-PK (Phospho-Ser2056) Antibody. The picture on the right is blocked with the phospho peptide.

Product Info

• Predicted Species Reactivity: Human|Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin
• Additional Information: Modification Sites: Human:S2056 Mouse:S2053
• Reconstitution and Storage: -20°C
• Immunogen: The antiserum was produced against synthesized peptide derived from human DNA-PK around the phosphorylation site of Ser2056.
• Purification: The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
• Peptide Sequence: Synthetic peptide located within the following region: PSYMSSLSYLADSTLSEEMSQFDFSTGVQSYSYSSQDPRPATGRFRRREQ
• Concentration: 1mg/ml
• Specificity: DNA-PK (Phospho-Ser2056) Antibody detects endogenous levels of DNA-PK only when phosphorylated at Ser2056.
• Formulation: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Application Info:
  IHC: 1:50~1:100
  ELISA: 1:10000

Target Info

• Gene Symbol: PRKDC
• Gene Full Name: protein kinase, DNA-activated, catalytic subunit
• Alias Symbols: DNA-dependent protein kinase catalytic subunit;DNAPK;DNA-PK catalytic subunit;DNAPKc;DNA-PKC;DNA-PKcs;DNPK1;hyper-radiosensitivity of murine scid mutation, complementing 1;HYRC;HYRC1;IMD26;p350;p460;protein kinase, DNA-activated, catalytic polypeptide;XRCC7.
• NCBI Gene Id: 5591
• Protein Name: DNA-dependent protein kinase catalytic subunit
• Description of Target: Serine/threonine-protein kinase that acts as a molecular sensor for DNA damage. Involved in DNA non-homologous end joining (NHEJ) required for double-strand break (DSB) repair and V(D)J recombination. Must be bound to DNA to express its catalytic properties. Promotes processing of hairpin DNA structures in V(D)J recombination by activation of the hairpin endonuclease artemis (DCLRE1C). The assembly of the DNA-PK complex at DNA ends is also required for the NHEJ ligation step. Required to protect and align broken ends of DNA. May also act as a scaffold protein to aid the localization of DNA repair proteins to the site of damage. Found at the ends of chromosomes, suggesting a further role in the maintenance of telomeric stability and the prevention of chromosomal end fusion. Also involved in modulation of transcription. Recognizes the substrate consensus sequence [ST]-Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX, thereby regulating DNA damage response mechanism. Phosphorylates DCLRE1C, c-Abl/ABL1, histone H1, HSPCA, c-jun/JUN, p53/TP53, PARP1, POU2F1, DHX9, SRF, XRCC1, XRCC1, XRCC4, XRCC5, XRCC6, WRN, MYC and RFA2. Can phosphorylate C1D not only in the presence of linear DNA but also in the presence of supercoiled DNA. Ability to phosphorylate p53/TP53 in the presence of supercoiled DNA is dependent on C1D. Contributes to the determination of the circadian period length by antagonizing phosphorylation of CRY1 'Ser-588' and increasing CRY1 protein stability, most likely through an indirect mechanism. Interacts with CRY1 and CRY2; negatively regulates CRY1 phosphorylation. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
• Uniprot ID: P78527
• Molecular Weight: 469 kDa