website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Hoxb9 antibody - middle region (ARP31956_P050)

  • Catalog#: ARP31956_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP31956_P050-FITC Conjugated

    ARP31956_P050-HRP Conjugated

    ARP31956_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Homeo box B9
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Replacement Item:
    This antibody may replace item sc-130377 from Santa Cruz Biotechnology.
    Description of Target:
    The function of this protein remains unknown.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express Hoxb9.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express Hoxb9.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-Hoxb9 (ARP31956_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Blocking Peptide:
    For anti-Hoxb9 (ARP31956_P050) antibody is Catalog # AAP31956 (Previous Catalog # AAPP02853)
    Datasheets / Downloads:
    Printable datasheet for anti-Hoxb9 (ARP31956_P050) antibody
    Ask a Question