website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

COLQ antibody - N-terminal region (ARP34362_P050)

Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
$289.00
In Stock

Conjugation Options

ARP34362_P050-FITC Conjugated

ARP34362_P050-HRP Conjugated

ARP34362_P050-Biotin Conjugated

Free trial-size samples may be available for this item. Please go here for more information.
Gene Symbol:
COLQ
NCBI Gene Id:
8292
Official Gene Full Name:
Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
Protein Name:
Acetylcholinesterase collagenic tail peptide
Swissprot Id:
Q9Y215-8
Protein Accession #:
NP_536805
Nucleotide Accession #:
NM_080544
Alias Symbols:
EAD
Replacement Item:
This antibody may replace item sc-133472 from Santa Cruz Biotechnology.
Description of Target:
COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
Protein Size (# AA):
329
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express COLQ.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express COLQ.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human COLQ
Species Reactivity:
Cow, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-COLQ (ARP34362_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; MUSK; BCHE; ACHE;
Blocking Peptide:
For anti-COLQ (ARP34362_P050) antibody is Catalog # AAP34362 (Previous Catalog # AAPY00137)
Datasheets / Downloads:
Printable datasheet for anti-COLQ (ARP34362_P050) antibody
Target Reference:
Ishigaki,K., et al., (2003) Neuromuscul. Disord. 13 (3), 236-244

Product Protocols: COLQ antibody tested with Human Hepg2 Cells (ARP34362_P050)

Aviva Systems Biology is the original manufacturer of this COLQ antibody (ARP34362_P050)

Click here to view the COLQ antibody Western Blot Protocol

Product Datasheet Link: COLQ antibody (ARP34362_P050)

WB Suggested Anti-COLQ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s COLQ antibody (ARP34362_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question