CD63 Antibody - middle region (ARP73782_P050)

Catalog No: ARP73782_P050

Host: Rabbit
Target Name: CD63
Sample Type: Hela Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Rabbit Anti-CD63 Antibody
Catalog Number: ARP73782_P050
Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue
Observed Staining: Cytoplasm in follicular cells
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CD63
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CD63 (ARP73782_P050) antibody is Catalog # AAP73782

Target Info

• Gene Symbol: CD63
• Alias Symbols: MLA1, ME491, LAMP-3, OMA81H, TSPAN30
• NCBI Gene Id: 967
• Description of Target: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
• Uniprot ID: P08962
• Protein Accession #: NP_001771
• Protein Size (# AA): 238
• Molecular Weight: 26kDa
• Protein Interactions: UBC; VKORC1; ATP6V1B1; env; RNF13; gag; CD81; PI4K2A; CD82; AP4M1; PTGFRN; TIMP1; ITGA6; CD9; HLA-DRA; HLA-DMB; SRF; ITGB1; HLA-DOB; KIT;