Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP58529_P050
Price: $0.00
SKU
ARP58529_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SOD2 (ARP58529_P050) antibody
Product Info
Tested Species ReactivityHuman, Rat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SOD2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH
Concentration0.5 mg/ml
Blocking PeptideFor anti-SOD2 (ARP58529_P050) antibody is Catalog # AAP58529 (Previous Catalog # AAPP34826)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceMartin,R.C., (2008) DNA Cell Biol. 27 (6), 321-323
Gene SymbolSOD2
Gene Full NameSuperoxide dismutase 2, mitochondrial
Alias SymbolsIPOB, IPO-B, MNSOD, MVCD6, GClnc1, Mn-SOD
NCBI Gene Id6648
Protein NameSuperoxide dismutase [Mn], mitochondrial
Description of TargetSOD2 is a member of the iron/manganese superoxide dismutase family. SOD2 is a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene encoding SOD2 have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer.This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Uniprot IDP04179
Protein Accession #NP_000627
Nucleotide Accession #NM_000636
Protein Size (# AA)222
Molecular Weight25 kDa
Protein InteractionsCYP4F12; UBC; SOD2; SOD1; APP; NABP2; TBL2; ZC3H11A; VAPA; STX7; UBL4A; ALDH5A1; USP36; H2AFX; SUMO1; NOL12; HDHD2; GET4; RPS3A; RAB4A; AURKA;
  1. What is the species homology for "SOD2 Antibody - N-terminal region (ARP58529_P050)"?

    The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".

  2. How long will it take to receive "SOD2 Antibody - N-terminal region (ARP58529_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SOD2 Antibody - N-terminal region (ARP58529_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SOD2 Antibody - N-terminal region (ARP58529_P050)"?

    This target may also be called "IPOB, IPO-B, MNSOD, MVCD6, GClnc1, Mn-SOD" in publications.

  5. What is the shipping cost for "SOD2 Antibody - N-terminal region (ARP58529_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SOD2 Antibody - N-terminal region (ARP58529_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SOD2 Antibody - N-terminal region (ARP58529_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SOD2 Antibody - N-terminal region (ARP58529_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SOD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SOD2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SOD2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SOD2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SOD2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SOD2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SOD2 Antibody - N-terminal region (ARP58529_P050)
Your Rating
We found other products you might like!