Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any help please email info@avivasysbio.com

Catalog No: ARP38430_P050
Price: $0.00
SKU
ARP38430_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-KLF4 (ARP38430_P050) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Paraffin embedded prostate tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human KLF4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH
Concentration0.5 mg/ml
Blocking PeptideFor anti-KLF4 (ARP38430_P050) antibody is Catalog # AAP38430 (Previous Catalog # AAPP23155)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceNatesampillai,S., Am. J. Physiol. Endocrinol. Metab. 294 (2), E385-E391 (2008)
Publications

BMP- and TGFβ-signaling regulate the formation of Müller glia-derived progenitor cells in the avian retina. Glia. 65, 1640-1655 (2017). 28703293

Description
Gene SymbolKLF4
Gene Full NameKruppel-like factor 4 (gut)
Alias SymbolsEZF, GKLF
NCBI Gene Id9314
Protein NameKrueppel-like factor 4
Description of TargetThe mammalian Kruppel-like transcription factor, KLF4 is involved in preventing centrosome amplification following DNA damage caused by gamma-irradiation. It is both necessary and sufficient in preventing centrosome amplification following gamma-radiation-induced DNA damage and does so by transcriptionally suppressing cyclin E expression n. Kruppel-like factor 4 is also known to exhibit checkpoint function during the G1/S and G2/M transitions of the cell cycle.
Uniprot IDO43474
Protein Accession #NP_004226
Nucleotide Accession #NM_004235
Protein Size (# AA)513
Molecular Weight55 kDa
Protein InteractionsEP300; CREBBP; SETD7; CTBP1; Dlg4; APP; CUL2; VHL; UBC; TCEB2; SP1; RELA; PRKCD; PPARG; SMARCA4; HDAC2; HDAC7; KAT5; HDAC1; HDAC5; ELK1; KLF6; TP53;
  1. What is the species homology for "KLF4 Antibody - C-terminal region (ARP38430_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "KLF4 Antibody - C-terminal region (ARP38430_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KLF4 Antibody - C-terminal region (ARP38430_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KLF4 Antibody - C-terminal region (ARP38430_P050)"?

    This target may also be called "EZF, GKLF" in publications.

  5. What is the shipping cost for "KLF4 Antibody - C-terminal region (ARP38430_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KLF4 Antibody - C-terminal region (ARP38430_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KLF4 Antibody - C-terminal region (ARP38430_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KLF4 Antibody - C-terminal region (ARP38430_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KLF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KLF4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KLF4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KLF4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KLF4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KLF4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KLF4 Antibody - C-terminal region (ARP38430_P050)
Your Rating
We found other products you might like!