website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PCBD2 antibody - C-terminal region (ARP60484_P050)

  • Catalog#: ARP60484_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP60484_P050-FITC Conjugated

    ARP60484_P050-HRP Conjugated

    ARP60484_P050-Biotin Conjugated

    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
    Protein Name:
    Pterin-4-alpha-carbinolamine dehydratase 2
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    Replacement Item:
    This antibody may replace item sc-152051 from Santa Cruz Biotechnology.
    Description of Target:
    PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express PCBD2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express PCBD2.
    Species Reactivity:
    Dog, Guinea Pig, Horse, Human, Mouse, Rat
    Predicted Homology Based on Immunogen Sequence:
    Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 85%
    Complete computational species homology data:
    Anti-PCBD2 (ARP60484_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-PCBD2 (ARP60484_P050) antibody is Catalog # AAPP47878
    Datasheets / Downloads:
    Printable datasheet for anti-PCBD2 (ARP60484_P050) antibody
    Ask a Question