Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP35157_P050
Price: $0.00
SKU
ARP35157_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

KCNB1 Antibody - C-terminal region (ARP35157_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-KCNB1 (ARP35157_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human KCNB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 85%; Pig: 93%; Rabbit: 86%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: MAKTQSQPILNTKESAAQSKPKEELEMESIPSPVAPLPTRTEGVIDMRSM
Concentration0.5 mg/ml
Blocking PeptideFor anti-KCNB1 (ARP35157_P050) antibody is Catalog # AAP35157
Gene SymbolKCNB1
Gene Full Namepotassium voltage-gated channel, Shab-related subfamily, member 1
Alias SymbolsDRK1, DEE26, Kv2.1
NCBI Gene Id3745
Protein NamePotassium voltage-gated channel subfamily B member 1
Description of TargetVoltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shab-related subfamily. This member is a delayed rectifier potassium channel and its activity is modulated by some other family members.
Uniprot IDQ14721
Protein Accession #NP_004966
Protein Size (# AA)858
Molecular Weight94kDa
Protein InteractionsSTX1A; KCNG3; KCNG4; KCNV1; KCNB2; KCNG1; KCNB1; SRC; SUMO1; NEDD4L; KCNV2; KCNG2; KCNS3; PTPRE; SNAP25; KCNH1;
  1. What is the species homology for "KCNB1 Antibody - C-terminal region (ARP35157_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "KCNB1 Antibody - C-terminal region (ARP35157_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "KCNB1 Antibody - C-terminal region (ARP35157_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "KCNB1 Antibody - C-terminal region (ARP35157_P050)"?

    This target may also be called "DRK1, DEE26, Kv2.1" in publications.

  5. What is the shipping cost for "KCNB1 Antibody - C-terminal region (ARP35157_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "KCNB1 Antibody - C-terminal region (ARP35157_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "KCNB1 Antibody - C-terminal region (ARP35157_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "94kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "KCNB1 Antibody - C-terminal region (ARP35157_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KCNB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KCNB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KCNB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KCNB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KCNB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KCNB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:KCNB1 Antibody - C-terminal region (ARP35157_P050)
Your Rating
We found other products you might like!