SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP37310_T100
Price: $0.00
SKU
ARP37310_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-TSG101 (ARP37310_T100) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
Concentration1.0 mg/ml
Blocking PeptideFor anti-TSG101 (ARP37310_T100) antibody is Catalog # AAP37310 (Previous Catalog # AAPS05712)
ReferenceStefan,M., (er) BMC Genomics 6, 157 (2005)
Publications

Isolation of Exosomes and Microvesicles from Cell Culture Systems to Study Prion Transmission. Methods Mol. Biol. 1545, 153-176 (2017). 27943213

Gene SymbolTSG101
Gene Full NameTumor susceptibility gene 101
Alias SymbolsCC2, AI255943
NCBI Gene Id22088
Protein NameTumor susceptibility gene 101 protein
Description of TargetTSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
Uniprot IDQ61187
Protein Accession #NP_068684
Nucleotide Accession #NM_021884
Protein Size (# AA)391
Molecular Weight43kDa
Protein InteractionsNr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;
  1. What is the species homology for "TSG101 Antibody - middle region (ARP37310_T100)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TSG101 Antibody - middle region (ARP37310_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TSG101 Antibody - middle region (ARP37310_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TSG101 Antibody - middle region (ARP37310_T100)"?

    This target may also be called "CC2, AI255943" in publications.

  5. What is the shipping cost for "TSG101 Antibody - middle region (ARP37310_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TSG101 Antibody - middle region (ARP37310_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TSG101 Antibody - middle region (ARP37310_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "43kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TSG101 Antibody - middle region (ARP37310_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TSG101"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TSG101"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TSG101"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TSG101"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TSG101"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TSG101"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TSG101 Antibody - middle region (ARP37310_T100)
Your Rating
We found other products you might like!