TPD52L1 Antibody - middle region (ARP82716_P050)

Catalog No: ARP82716_P050

Host: Rabbit
Target Name: TPD52L1
Sample Tissue: Human Leiomyosarcoma Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TPD52L1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: MPAMRNSPTFKSFEERVETTVTSLKTKVGGTNPNGGSFEEVLSSTAHASA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TPD52L1 (ARP82716_P050) antibody is Catalog # AAP82716

Target Info

• Gene Symbol: TPD52L1
• Gene Full Name: tumor protein D52-like 1
• Alias Symbols: D53, TPD53
• NCBI Gene Id: 7164
• Protein Name: tumor protein D53
• Description of Target: This gene encodes a member of a family of proteins that contain coiled-coil domains and may form hetero- or homomers. The encoded protein is involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed.
• Uniprot ID: Q16890-5
• Protein Accession #: NP_001003395.1
• Nucleotide Accession #: NM_001003395.1
• Protein Size (# AA): 175
• Molecular Weight: 19 kDa