website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GH2 antibody - middle region (ARP42013_T100)

  • Catalog#: ARP42013_T100
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    In Stock

    Conjugation Options

    ARP42013_T100-FITC Conjugated

    ARP42013_T100-HRP Conjugated

    ARP42013_T100-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Growth hormone 2
    Protein Name:
    Growth hormone variant
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    GH-V, GHL, GHV, hGH-V
    Replacement Item:
    This antibody may replace item sc-10364 from Santa Cruz Biotechnology.
    Description of Target:
    GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.
    Protein Size (# AA):
    Molecular Weight:
    Protein A purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express GH2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express GH2.
    The immunogen is a synthetic peptide directed towards the middle region of human GH2
    Species Reactivity:
    Cow, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
    Complete computational species homology data:
    Anti-GH2 (ARP42013_T100)
    Peptide Sequence:
    Synthetic peptide located within the following region: NQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSC
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-GH2 (ARP42013_T100) antibody is Catalog # AAP42013 (Previous Catalog # AAPS11506)
    Datasheets / Downloads:
    Printable datasheet for anti-GH2 (ARP42013_T100) antibody
    Target Reference:
    Lacroix,M.C., (2005) Endocrinology 146 (5), 2434-2444

    Product Protocols: GH2 antibody tested with Human Placenta Tissue (ARP42013_T100)

    Aviva Systems Biology is the original manufacturer of this GH2 antibody (ARP42013_T100)

    Click here to view the GH2 antibody Western Blot Protocol

    Product Datasheet Link: GH2 antibody (ARP42013_T100)

    WB Suggested Anti-GH2 Antibody Titration: 5.0ug/ml
    Positive Control: Placenta

    Western Blot image:

    Description of Target: GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s GH2 antibody (ARP42013_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question