website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

GCG antibody - N-terminal region (ARP42010_T100)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $229.00

Special Price: $115.00

In Stock

Conjugation Options

ARP42010_T100-FITC Conjugated

ARP42010_T100-HRP Conjugated

ARP42010_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-110125 from Santa Cruz Biotechnology.
Description of Target:
GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express GCG.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express GCG.
The immunogen is a synthetic peptide directed towards the N terminal region of human GCG
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-GCG (ARP42010_T100)
Peptide Sequence:
Synthetic peptide located within the following region: LSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-GCG (ARP42010_T100) antibody is Catalog # AAP42010 (Previous Catalog # AAPS11503)
Datasheets / Downloads:
Printable datasheet for anti-GCG (ARP42010_T100) antibody
Target Reference:
Meier,J.J., (2006) Gastroenterology 130 (1), 44-54

Product Protocols: GCG antibody tested with Human Jurkat Cells (ARP42010_T100)

Aviva Systems Biology is the original manufacturer of this GCG antibody (ARP42010_T100)

Click here to view the GCG antibody Western Blot Protocol

Product Datasheet Link: GCG antibody (ARP42010_T100)

WB Suggested Anti-GCG Antibody Titration: 1.25ug/ml
Positive Control: Jurkat

Western Blot image:

Description of Target: GCG is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s GCG antibody (ARP42010_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...