website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

ESR1 antibody - C-terminal region (ARP31088_P050)

  • Catalog#: ARP31088_P050
  • Domestic: within 1-2 days delivery International: 1-2 days
    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges
    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Free trial-size samples may be available for this item. Please go here for more information.
Print Page
100 ul
    $289.00
    In Stock

    Conjugation Options

    ARP31088_P050-FITC Conjugated

    ARP31088_P050-HRP Conjugated

    ARP31088_P050-Biotin Conjugated

    Free trial-size samples may be available for this item. Please go here for more information.
    Gene Symbol:
    ESR1
    NCBI Gene Id:
    2099
    Official Gene Full Name:
    Estrogen receptor 1
    Protein Name:
    Estrogen receptor
    Swissprot Id:
    P03372
    Protein Accession #:
    NP_000116
    Nucleotide Accession #:
    NM_000125
    Alias Symbols:
    DKFZp686N23123, ER, ESR, ESRA, Era, NR3A1
    Replacement Item:
    This antibody may replace item sc-102391 from Santa Cruz Biotechnology.
    Description of Target:
    ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.
    Protein Size (# AA):
    595
    Molecular Weight:
    66kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express ESR1.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express ESR1.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the C terminal region of human ESR1
    Species Reactivity:
    Human
    Predicted Homology Based on Immunogen Sequence:
    Human: 100%
    Complete computational species homology data:
    Anti-ESR1 (ARP31088_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: AHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    SRC; DDX5; POLR2C; POLR2B; POLR2A; MSH2; TTC5; KAT5; NCOA2; BRCA1; MED24; UBC; PSMB9; MED1; POLR2L; POLR2K; POLR2J; POLR2I; POLR2H; POLR2G; POLR2F; POLR2E; POLR2D; ASCC1; TRRAP; PHB2; NCOR1; NCOA1; PIK3CA; IGF1R; HDAC1; NSD1; WIPI1; ESR1; ZNF131; RANBP9;
    Blocking Peptide:
    For anti-ESR1 (ARP31088_P050) antibody is Catalog # AAP31088
    Datasheets / Downloads:
    Printable datasheet for anti-ESR1 (ARP31088_P050) antibody

    Product Protocols: ESR1 antibody tested with Human Achn Cells (ARP31088_P050)

    Aviva Systems Biology is the original manufacturer of this ESR1 antibody (ARP31088_P050)

    Click here to view the ESR1 antibody Western Blot Protocol

    Product Datasheet Link: ESR1 antibody (ARP31088_P050)

    WB Suggested Anti-ESR1 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:12500
    Positive Control: ACHN

    Western Blot image:


    Description of Target: ESR1 is an estrogen receptor, a ligand-activated transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. The protein localizes to the nucleus where it may form a homodimer or a heterodimer with estrogen receptor 2. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Estrogen receptors are also involved in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in several transcript variants, which differ in their 5' UTRs and use different promoters.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s ESR1 antibody (ARP31088_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question