website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

lab antibody - N-terminal region (ARP47876_P050)

  • Catalog#: ARP47876_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    lab
    NCBI Gene Id:
    40817
    Official Gene Full Name:
    Labial
    Swissprot Id:
    P10105
    Protein Accession #:
    CAA31495
    Alias Symbols:
    Dmel_CG1264, BG:DS00004.9, CG1264, DmLab, EfR9, F121, F24, F90, F90-2, l(3)01241, l(3)84Ac, lb, Dm lab, Dmel\CG1264, Dmlab, Lab
    Description of Target:
    lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.
    Protein Size (# AA):
    495
    Molecular Weight:
    54kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express lab.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express lab.
    Immunogen:
    The immunogen is a synthetic peptide corresponding to a region of Fruit fly
    Predicted Homology Based on Immunogen Sequence:
    Fruit fly:100%;
    Complete computational species homology data:
    Anti-lab (ARP47876_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: MMDVSSMYGNHPHHHHPHANAYDGYSTTTASAANASSYFAPQQHQPHLQL
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Abd-B; abd-A; Ubx; Antp; Scr; Dfd; pb;
    Blocking Peptide:
    For anti-lab (ARP47876_P050) antibody is Catalog # AAP47876 (Previous Catalog # AAPP27320)
    Datasheets / Downloads:
    Printable datasheet for anti-lab (ARP47876_P050) antibody

    Product Protocols: lab antibody tested with Human Drosophila (ARP47876_P050)

    Aviva Systems Biology is the original manufacturer of this lab antibody (ARP47876_P050)

    Click here to view the lab antibody Western Blot Protocol

    Product Datasheet Link: lab antibody (ARP47876_P050)

    WB Suggested Anti-lab Antibody Titration: 0.2-1 ug/ml
    Positive Control: Drosophila

    Western Blot image:


    Description of Target: lab is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It is required for proper head development.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s lab antibody (ARP47876_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

    Product Protocols: lab antibody tested by IHC with human kidney (ARP47876)

    Aviva Systems Biology is the original manufacturer of this lab antibody.

    Click here to view the lab antibody Immunohistochemistry (IHC) protocol

    Product Datasheet Link: lab antibody (ARP47876)

    IHC Information:

    Rabbit Anti-lab Antibody
    Catalog Number: ARP47876
    Paraffin Embedded Tissue: Human Kidney
    Cellular Data: Epithelial cells of renal tubule
    Antibody Concentration: 4.0-8.0 ug/ml
    Magnification: 400X

    IHC Image:

     
    X
    Ask a Question