KRTAP23-1 Antibody - middle region (ARP45936_P050)

Catalog No: ARP45936_P050

WB Suggested Anti-KRTAP23-1 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRTAP23-1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-KRTAP23-1 (ARP45936_P050) antibody is Catalog # AAP45936 (Previous Catalog # AAPS16708)

Target Info

• Gene Symbol: KRTAP23-1
• Gene Full Name: Keratin associated protein 23-1
• Alias Symbols: KAP23.1
• NCBI Gene Id: 337963
• Protein Name: Keratin-associated protein 23-1
• Description of Target: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
• Uniprot ID: A1A580
• Protein Accession #: NP_853655
• Nucleotide Accession #: NM_181624
• Protein Size (# AA): 65
• Molecular Weight: 7kDa
• Protein Interactions: RBPMS; BHLHE40;