website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

KIF23 antibody - N-terminal region (ARP33963_T100)

  • Catalog#: ARP33963_T100
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $229.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    KIF23
    NCBI Gene Id:
    9493
    Official Gene Full Name:
    Kinesin family member 23
    Protein Name:
    Kinesin-like protein KIF23
    Swissprot Id:
    Q02241
    Protein Accession #:
    NP_004847
    Nucleotide Accession #:
    NM_004856
    Alias Symbols:
    CHO1, KNSL5, MKLP1, MKLP-1
    Description of Target:
    KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
    Protein Size (# AA):
    856
    Molecular Weight:
    98kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Protein A purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express KIF23.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express KIF23.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human KIF23
    Species Reactivity:
    Cow, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
    Complete computational species homology data:
    Anti-KIF23 (ARP33963_T100)
    Peptide Sequence:
    Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    UBC; YWHAQ; YWHAE; RACGAP1; XRCC6; IKBKG; SIRT7; SH3KBP1; SUMO2; Kif23; Dctn2; Shcbp1; Cd2ap; YWHAZ; YWHAH; YWHAG; YWHAB; STK11; CENPA; PRC1; FYCO1; PLK1; ARF3; ACTA1; BIRC6; USP8; PKLR; SFN;
    Blocking Peptide:
    For anti-KIF23 (ARP33963_T100) antibody is Catalog # AAP33963 (Previous Catalog # AAPP05038)
    Datasheets / Downloads:
    Printable datasheet for anti-KIF23 (ARP33963_T100) antibody
    Target Reference:
    Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65

    Product Protocols: KIF23 antibody tested with Human Jurkat Cells (ARP33963_T100)

    Aviva Systems Biology is the original manufacturer of this KIF23 antibody (ARP33963_T100)

    Click here to view the KIF23 antibody Western Blot Protocol

    Product Datasheet Link: KIF23 antibody (ARP33963_T100)

    WB Suggested Anti-KIF23 Antibody Titration: 1.25ug/ml
    Positive Control: Jurkat

    Western Blot image:


    Description of Target: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s KIF23 antibody (ARP33963_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question