SYMPK Antibody - N-terminal region (ARP42900_P050)

Catalog No: ARP42900_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-SYMPK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver

Sample Type:
Human HT29 cells
Primary Antibody Dilution:
1:50
Secondary Antibody:
Donkey anti Rabbit-Alexa Fluor 488
Secondary Antibody Dilution:
1:500
Color/Signal Descriptions:
Green: Symplekin Blue: DAPI
Gene Name:
SYMPK
Submitted by:
Louise Lagerqvist (PhD), Oncology Department, Institute of Functional Genomics, Montpellier, France.

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SYMPK
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: RTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SYMPK (ARP42900_P050) antibody is Catalog # AAP42900 (Previous Catalog # AAPP11125)
• Reference: Cao,Y., (2007) Histopathology 51 (4), 528-538

Target Info

• Gene Symbol: SYMPK
• Gene Full Name: Symplekin
• Alias Symbols: SPK, SYM
• NCBI Gene Id: 8189
• Protein Name: Symplekin
• Description of Target: SYMPK is a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types.This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q92797
• Protein Accession #: NP_004810
• Nucleotide Accession #: NM_004819
• Protein Size (# AA): 1274
• Molecular Weight: 141kDa
• Protein Interactions: KAT6A; VCP; KMT2A; UBC; WWOX; RPA3; RPA2; RPA1; SSU72; CPSF2; CPSF3; TOP1; SUMO1; SIRT7; SUMO2; SMARCAD1; CSTF2; HTT; HSF1;