website statistics

Aviva Systems Biology office will be closed for Memorial Day - 5/29/2017.
Please go here for more info.

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CBX4 antibody - N-terminal region (ARP30002_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30002_P050-FITC Conjugated

ARP30002_P050-HRP Conjugated

ARP30002_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Chromobox homolog 4
Protein Name:
E3 SUMO-protein ligase CBX4
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
PC2, NBP16
Replacement Item:
This antibody may replace item sc-19299, HPA008228
Description of Target:
The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CBX4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CBX4.
The immunogen is a synthetic peptide directed towards the N terminal region of human CBX4
Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
Complete computational species homology data:
Anti-CBX4 (ARP30002_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLIAFQNRERQEQLMGYRKRGPKPKPLVVQVPTFARRSNVLTGLQDSSTD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CBX4 (ARP30002_P050) antibody is Catalog # AAP30002 (Previous Catalog # AAPH00102)
Datasheets / Downloads:
Printable datasheet for anti-CBX4 (ARP30002_P050) antibody
Sample Type Confirmation:

CBX4 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Kagey,M.H., et al., (2003) Cell 113 (1), 127-137

Hao, L., Midic, U., Garriga, J. & Latham, K. E. Contribution of CBX4 to cumulus oophorus cell phenotype in mice and attendant effects in cumulus cell cloned embryos. Physiol. Genomics 46, 66-80 (2014). WB, Bovine, Dog, Pig, Rabbit, Rat, Guinea pig, Human, Mouse, Zebrafish 24280258

Product Protocols: CBX4 antibody tested with Human Jurkat Cells (ARP30002_P050)

Aviva Systems Biology is the original manufacturer of this CBX4 antibody (ARP30002_P050)

Click here to view the CBX4 antibody Western Blot Protocol

Product Datasheet Link: CBX4 antibody (ARP30002_P050)

WB Suggested Anti-CBX4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:

Description of Target: The polycomb group (PcG) protein HPC2, which functions as a transcriptional suppressor, is a candidate of KyoT2-binding proteins. Pc2 dramatically enhances CtBP sumoylation. Pc2 is a SUMO E3, and Polycomb Group bodies may be sumoylation centers.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CBX4 antibody (ARP30002_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: CBX4 antibody tested by IHC with human kidney (ARP30002)

Aviva Systems Biology is the original manufacturer of this CBX4 antibody.

Click here to view the CBX4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: CBX4 antibody (ARP30002)

IHC Information:

Rabbit Anti-CBX 4 Antibody
Catalog Number: ARP30002
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...