website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

ZNF341 antibody - middle region (ARP30014_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The ZNF341 gene is located on chromosome 20.
Gene Symbol:
ZNF341
Official Gene Full Name:
Zinc finger protein 341
NCBI Gene Id:
84905
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ZNF341.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ZNF341.
Swissprot Id:
Q9BYN7
Protein Accession #:
NP_116208
Nucleotide Accession #:
NM_032819
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Zinc finger protein 341
Protein Size (# AA):
847
Molecular Weight:
92kDa
Application:
IHC, WB
Protein Interactions:
CENPP; KLHL38; WDYHV1; MAGEB4; CSTF2; ARNT2; PRPF40A;
Immunogen:
The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the middle region of human ZNF341
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
ZNF341 antibody - middle region (ARP30014_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%
Species Reactivity:
Human, Mouse, Bovine, Dog, Rabbit, Guinea pig, Horse
Datasheets / Downloads:
Printable datasheet for
anti-ZNF341 antibody
- ARP30014_P050
Peptide Sequence:
Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
Blocking Peptide:
For anti-ZNF341 antibody is Catalog # AAP30014 (Previous Catalog # AAPH00114)
Target Reference:
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: ZNF341 antibody tested with Human Hepg2 Cells (ARP30014_P050)

Aviva Systems Biology is the original manufacturer of this ZNF341 antibody (ARP30014_P050)

Click here to view the ZNF341 antibody Western Blot Protocol

Product Datasheet Link: ZNF341 antibody (ARP30014_P050)

WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: The ZNF341 gene is located on chromosome 20.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ZNF341 antibody (ARP30014_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: ZNF341 antibody tested by IHC with human intestine (ARP30014)

Aviva Systems Biology is the original manufacturer of this ZNF341 antibody.

Click here to view the ZNF341 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ZNF341 antibody (ARP30014)

IHC Information:

Rabbit Anti-ZNF341 Antibody
Catalog Number: ARP30014
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question