website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

ZNF341 antibody - middle region (ARP30014_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The ZNF341 gene is located on chromosome 20.
Gene Symbol:
ZNF341
Official Gene Full Name:
Zinc finger protein 341
NCBI Gene Id:
84905
Tissue Tool:
Find tissues and cell lines supported to express ZNF341.
Protein Accession #:
NP_116208
Nucleotide Accession#:
NM_032819
Swissprot Id:
Q9BYN7
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Zinc finger protein 341
Protein Size (# AA):
847
Molecular Weight:
92kDa
Application:
IHC, WB
Partner Proteins:
MED31, MED31
Immunogen:
The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the middle region of human ZNF341
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
ZNF341 antibody - middle region (ARP30014_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%
Species Reactivity:
Human, Mouse, Bovine, Dog, Rabbit, Guinea pig, Horse
Datasheets / Downloads:
Printable datasheet for
anti-ZNF341 antibody
- ARP30014_P050
Peptide Sequence:
Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
Blocking Peptide:
For anti-ZNF341 antibody is Catalog # AAP30014 (Previous Catalog # AAPH00114)
Target Reference:
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ZNF341 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for ZNF341 antibody (ARP30014)

Product page for ZNF341 antibody (ARP30014)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant ZNF341 antibody; Loxodonta africana ZNF341 antibody G3UGS2 85%
African elephant ZNF341 antibody; Loxodonta africana ZNF341 antibody G3SZF7 85%
Bovine ZNF341 antibody; Bos taurus ZNF341 antibody E1BE18 85%
Dog ZNF341 antibody; Canis familiaris ZNF341 antibody E2RHS4 85%
Giant panda ZNF341 antibody; Ailuropoda melanoleuca ZNF341 antibody G1LR11 85%
Guinea pig LOC100734523 antibody; Cavia porcellus LOC100734523 antibody H0V1S0 85%
Human ZN341 antibody; Homo sapiens ZN341 antibody Q9BYN7 100%
Human ZN341 antibody; Homo sapiens ZN341 antibody Q9BYN7-2 100%
Human ZNF341 antibody; Homo sapiens ZNF341 antibody Q504V9 100%
Human ZNF341 antibody; Homo sapiens ZNF341 antibody E9PN62 100%
Human ZNF341 antibody; Homo sapiens ZNF341 antibody B3KU97 100%
Little brown bat ZNF341 antibody; Myotis lucifugus ZNF341 antibody G1PS87 78%
Lowland gorilla ZNF341 antibody; Gorilla gorilla gorilla ZNF341 antibody G3RQQ4 92%
Lowland gorilla ZNF341 antibody; Gorilla gorilla gorilla ZNF341 antibody G3RI98 92%
Mouse Zfp341 antibody; Mus musculus Zfp341 antibody Q6PGC9 92%
Mouse Zfp341 antibody; Mus musculus Zfp341 antibody A2AVM0 92%
Northern white-cheeked gibbon ZNF341 antibody; Nomascus leucogenys ZNF341 antibody G1RG59 92%
Rabbit ZNF341 antibody; Oryctolagus cuniculus ZNF341 antibody G1U4X3 85%
Rat LOC296300 antibody; Rattus norvegicus LOC296300 antibody F1LND8 85%
Rhesus macaque ZNF341 antibody; Macaca mulatta ZNF341 antibody F7FKF8 92%
Rhesus macaque ZNF341 antibody; Macaca mulatta ZNF341 antibody F7FKF4 92%
Small-eared galago ZNF341 antibody; Otolemur garnettii ZNF341 antibody H0X2P7 85%
White-tufted-ear marmoset ZNF341 antibody; Callithrix jacchus ZNF341 antibody F6WE70 92%
White-tufted-ear marmoset ZNF341 antibody; Callithrix jacchus ZNF341 antibody F6WE12 92%

Product Protocols: ZNF341 antibody tested with Human Hepg2 Cells (ARP30014_P050)

Aviva Systems Biology is the original manufacturer of this ZNF341 antibody (ARP30014_P050)

Click here to view the ZNF341 antibody Western Blot Protocol

Product Datasheet Link: ZNF341 antibody (ARP30014_P050)

WB Suggested Anti-ZNF341 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: The ZNF341 gene is located on chromosome 20.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s ZNF341 antibody (ARP30014_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: ZNF341 antibody tested by IHC with human intestine (ARP30014)

Aviva Systems Biology is the original manufacturer of this ZNF341 antibody.

Click here to view the ZNF341 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: ZNF341 antibody (ARP30014)

IHC Information:

Rabbit Anti-ZNF341 Antibody
Catalog Number: ARP30014
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

 
X
Ask a Question