website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

ZNF341 antibody - middle region (ARP30014_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
The ZNF341 gene is located on chromosome 20.
Gene Symbol:
ZNF341
Official Gene Full Name:
Zinc finger protein 341
NCBI Gene Id:
84905
Tissue Tool:
Find tissues and cell lines supported to express ZNF341.
Protein Accession #:
NP_116208
Nucleotide Accession#:
NM_032819
Swissprot Id:
Q9BYN7
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Zinc finger protein 341
Protein Size (# AA):
847
Molecular Weight:
92kDa
Application:
IHC, WB
Partner Proteins:
MED31, MED31
Immunogen:
The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the middle region of human ZNF341
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
ZNF341 antibody - middle region (ARP30014_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%
Species Reactivity:
Human, Mouse, Bovine, Dog, Rabbit, Guinea pig, Horse
Datasheets / Downloads:
Printable datasheet for
anti-ZNF341 antibody
- ARP30014_P050
Peptide Sequence:
Synthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
Blocking Peptide:
For anti-ZNF341 antibody is Catalog # AAP30014 (Previous Catalog # AAPH00114)
Key Reference:
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-ZNF341 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question