website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

Zbtb37 antibody - middle region (ARP30048_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
Zbtb37
NCBI Gene Id:
240869
Official Gene Full Name:
Zinc finger and BTB domain containing 37
Protein Name:
Protein Zbtb37 Ensembl ENSMUSP00000125253 Ensembl ENSMUSP00000125417 Ensembl ENSMUSP00000131576 Ensembl ENSMUSP00000134769 Ensembl ENSMUSP00000134753
Swissprot Id:
Q8C3U9
Protein Accession #:
NP_775600
Nucleotide Accession #:
NM_173424
Alias Symbols:
D430004I08Rik
Description of Target:
The function of this protein remains unknown.
Protein Size (# AA):
504
Molecular Weight:
56kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Zbtb37.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Zbtb37.
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-Zbtb37 (ARP30048_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Zbtb37 (ARP30048_P050) antibody is Catalog # AAP30048
Datasheets / Downloads:
Printable datasheet for anti-Zbtb37 (ARP30048_P050) antibody
 
X
Ask a Question