- Description of Target:
- The function of this protein remains unknown.
- Gene Symbol:
- Zbtb37
- Official Gene Full Name:
- Zinc finger and BTB domain containing 37
- Alias Symbols:
- D430004I08Rik
- Tissue Tool:
- Find tissues and cell lines supported to express Zbtb37.
- Protein Accession# :
- NP_775600
- Nucleotide Accession#:
- NM_173424
- Swissprot Id:
- Q8C3U9
- Host:
- Rabbit
- Protein Size (# AA):
- 504
- Molecular Weight:
- 56kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Zbtb37 antibody - middle region (ARP30048_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-Zbtb37 antibody
- ARP30048_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
- Blocking Peptide:
- For anti-Zbtb37 antibody is Catalog # AAP30048
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Zbtb37 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
