website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

Zbtb37 antibody - middle region (ARP30048_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Zbtb37
Official Gene Full Name:
Zinc finger and BTB domain containing 37
NCBI Gene Id:
240869
Alias Symbols:
D430004I08Rik
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Zbtb37.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Zbtb37.
Swissprot Id:
Q8C3U9
Protein Accession #:
NP_775600
Nucleotide Accession #:
NM_173424
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Protein Zbtb37 Ensembl ENSMUSP00000125253 Ensembl ENSMUSP00000125417 Ensembl ENSMUSP00000131576 Ensembl ENSMUSP00000134769 Ensembl ENSMUSP00000134753
Protein Size (# AA):
504
Molecular Weight:
56kDa
Application:
WB
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Zbtb37 antibody - middle region (ARP30048_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Rat, Bovine, Dog, Pig, Horse, Mouse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Zbtb37 antibody
- ARP30048_P050
Peptide Sequence:
Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
Blocking Peptide:
For anti-Zbtb37 antibody is Catalog # AAP30048
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
 
X
Ask a Question