website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Zbtb37 antibody - middle region (ARP30048_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Official Gene Full Name:
Zinc finger and BTB domain containing 37
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express Zbtb37.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Zbtb37 Ensembl ENSMUSP00000125253 Ensembl ENSMUSP00000125417 Ensembl ENSMUSP00000131576 Ensembl ENSMUSP00000134769 Ensembl ENSMUSP00000134753
Protein Size (# AA):
Molecular Weight:
Product Format:
Lyophilized powder
Complete computational species homology data:
Zbtb37 antibody - middle region (ARP30048_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Species Reactivity:
Human, Rat, Bovine, Dog, Pig, Horse, Mouse, Rabbit, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Zbtb37 antibody
- ARP30048_P050
Peptide Sequence:
Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
Blocking Peptide:
For anti-Zbtb37 antibody is Catalog # AAP30048
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Zbtb37 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for Zbtb37 antibody (ARP30048)

Product page for Zbtb37 antibody (ARP30048)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant ZBTB37 antibody; Loxodonta africana ZBTB37 antibody G3SU43 100%
Bovine ZBTB37 antibody; Bos taurus ZBTB37 antibody F1N518 100%
Chicken ZBTB37 antibody; Gallus gallus ZBTB37 antibody F1NK65 100%
Common turkey ZBTB37 antibody; Meleagris gallopavo ZBTB37 antibody G1MT04 100%
Dog ZBTB37 antibody; Canis familiaris ZBTB37 antibody F1PD18 100%
Dog ZBTB37 antibody; Canis familiaris ZBTB37 antibody F1PD17 100%
Duckbill platypus ZBTB37 antibody; Ornithorhynchus anatinus ZBTB37 antibody F6QG01 100%
Duckbill platypus ZBTB37 antibody; Ornithorhynchus anatinus ZBTB37 antibody F6QFZ2 100%
Duckbill platypus ZBTB37 antibody; Ornithorhynchus anatinus ZBTB37 antibody F6QFY2 100%
Giant panda ZBTB37 antibody; Ailuropoda melanoleuca ZBTB37 antibody D2H5I2 100%
Gray short-tailed opossum ZBTB37 antibody; Monodelphis domestica ZBTB37 antibody F6XPY7 100%
Gray short-tailed opossum ZBTB37 antibody; Monodelphis domestica ZBTB37 antibody F6UBR2 100%
Gray short-tailed opossum ZBTB37 antibody; Monodelphis domestica ZBTB37 antibody F6UBL7 100%
Green anole ZBTB37 antibody; Anolis carolinensis ZBTB37 antibody G1KR30 100%
Guinea pig LOC100724774 antibody; Cavia porcellus LOC100724774 antibody H0V2Y1 100%
Horse ZBTB37 antibody; Equus caballus ZBTB37 antibody F7AFF7 100%
Human ZBT37 antibody; Homo sapiens ZBT37 antibody Q5TC79 100%
Human ZBT37 antibody; Homo sapiens ZBT37 antibody Q5TC79-3 100%
Human ZBT37 antibody; Homo sapiens ZBT37 antibody Q5TC79-2 100%
Human ZBTB37 antibody; Homo sapiens ZBTB37 antibody Q8WYT0 100%
Human ZBTB37 antibody; Homo sapiens ZBTB37 antibody F8W751 100%
Little brown bat ZBTB37 antibody; Myotis lucifugus ZBTB37 antibody G1PHF5 100%
Lowland gorilla ZBTB37 antibody; Gorilla gorilla gorilla ZBTB37 antibody G3QDJ7 100%
Mouse Zbtb37 antibody; Mus musculus Zbtb37 antibody Q8C5F2 100%
Mouse Zbtb37 antibody; Mus musculus Zbtb37 antibody Q8C3U9 100%
Mouse Zbtb37 antibody; Mus musculus Zbtb37 antibody Q3ULY8 100%
Mouse Zbtb37 antibody; Mus musculus Zbtb37 antibody Q3UFR3 100%
Mouse Zbtb37 antibody; Mus musculus Zbtb37 antibody Q14CI5 100%
Northern white-cheeked gibbon ZBTB37 antibody; Nomascus leucogenys ZBTB37 antibody G1RZB8 100%
Pig ZBTB37 antibody; Sus scrofa ZBTB37 antibody F1S741 100%
Rabbit ZBTB37 antibody; Oryctolagus cuniculus ZBTB37 antibody G1TDR9 100%
Rat Zbtb37 antibody; Rattus norvegicus Zbtb37 antibody D3ZGJ3 100%
Rhesus macaque ZBTB37 antibody; Macaca mulatta ZBTB37 antibody F7CXC0 100%
Rhesus macaque ZBTB37 antibody; Macaca mulatta ZBTB37 antibody F6UXC9 100%
Rhesus macaque ZBTB37 antibody; Macaca mulatta ZBTB37 antibody F6UWZ3 100%
Small-eared galago ZBTB37 antibody; Otolemur garnettii ZBTB37 antibody H0XHP6 100%
Tasmanian devil ZBTB37 antibody; Sarcophilus harrisii ZBTB37 antibody G3VX77 100%
Western clawed frog zbtb37 antibody; Xenopus tropicalis zbtb37 antibody F6YV74 92%
White-tufted-ear marmoset ZBTB37 antibody; Callithrix jacchus ZBTB37 antibody F6XBK3 100%
White-tufted-ear marmoset ZBTB37 antibody; Callithrix jacchus ZBTB37 antibody F6WPG3 100%
White-tufted-ear marmoset ZBTB37 antibody; Callithrix jacchus ZBTB37 antibody F6UZ85 100%
White-tufted-ear marmoset ZBTB37 antibody; Callithrix jacchus ZBTB37 antibody F6UDV9 100%
Zebra finch ZBTB37 antibody; Taeniopygia guttata ZBTB37 antibody H1A5X9 92%
Ask a Question