website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

US

Zbtb37 antibody - middle region (ARP30048_P050)

  • Catalog#: ARP30048_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    Zbtb37
    NCBI Gene Id:
    240869
    Official Gene Full Name:
    Zinc finger and BTB domain containing 37
    Protein Name:
    Protein Zbtb37 Ensembl ENSMUSP00000125253 Ensembl ENSMUSP00000125417 Ensembl ENSMUSP00000131576 Ensembl ENSMUSP00000134769 Ensembl ENSMUSP00000134753
    Swissprot Id:
    Q8C3U9
    Protein Accession #:
    NP_775600
    Nucleotide Accession #:
    NM_173424
    Alias Symbols:
    D430004I08Rik
    Description of Target:
    The function of this protein remains unknown.
    Protein Size (# AA):
    504
    Molecular Weight:
    56kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express Zbtb37.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express Zbtb37.
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-Zbtb37 (ARP30048_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Blocking Peptide:
    For anti-Zbtb37 (ARP30048_P050) antibody is Catalog # AAP30048
    Datasheets / Downloads:
    Printable datasheet for anti-Zbtb37 (ARP30048_P050) antibody
     
    X
    Ask a Question