- Description of Target:
- GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
- Gene Symbol:
- GABPB2
- Official Gene Full Name:
- GA binding protein transcription factor, beta subunit 1
- Alias Symbols:
- BABPB2; E4TF1; E4TF1-47; E4TF1-53; E4TF1B; GABPB; GABPB1; NRF2B1; NRF2B2; GABPB2
- Tissue Tool:
- Find tissues and cell lines supported to express GABPB2.

- Protein Accession# :
- NP_002032
- Nucleotide Accession#:
- NM_002041
- Swissprot Id:
- Q06547
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 360
- Molecular Weight:
- 38kDa
- Application:
- WB
- Subunit:
- beta-1
- Partner Proteins:
- DSCAM, NRIP1, TFF1, XBP1, AR, HIST3H3, AR, ONECUT1
- Immunogen:
- The immunogen for anti-GABPB2 antibody: synthetic peptide directed towards the N terminal of human GABPB2
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- GABPB2 antibody - N-terminal region (ARP57863_P050)
- Predicted Homology Based on Immunogen Sequence:
- Chicken: 100%; Dog: 85%; Guinea pig: 85%; Horse: 85%; Human: 85%; Mouse: 85%; Rabbit: 85%; Rat: 85%; Zebrafish: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-GABPB2 antibody
- ARP57863_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGH
- Blocking Peptide:
- For anti-GABPB2 antibody is Catalog # AAP57863 (Previous Catalog # AAPP32216)
- Key Reference:
- Crook,M.F., (2008) FASEB J. 22 (1), 225-235
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-GABPB2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: GABPB2 antibody tested with Human Transfected 293T Cells (ARP57863_P050)
Aviva Systems Biology is the original manufacturer of this GABPB2 antibody (ARP57863_P050)
Click here to view the GABPB2 antibody Western Blot Protocol
Product Datasheet Link: GABPB2 antibody (ARP57863_P050)
WB Suggested Anti-GABPB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: GABPB2 is the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene. This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes. The encoded protein may be involved in activation of cytochrome oxidase expression and nuclear control of mitochondrial function. The crystal structure of a similar protein in mouse has been resolved as a ternary protein complex. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s GABPB2 antibody (ARP57863_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


