- Description of Target:
- SOX6 is a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. SOX6 is a trans
- Gene Symbol:
- SOX6
- Official Gene Full Name:
- SRY (sex determining region Y)-box 6
- Alias Symbols:
- HSSOX6; SOXD
- Tissue Tool:
- Find tissues and cell lines supported to express SOX6.

- Protein Accession# :
- NP_059978
- Nucleotide Accession#:
- NM_017508
- Swissprot Id:
- P35712
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 804
- Molecular Weight:
- 89kDa
- Application:
- WB
- Partner Proteins:
- MPP3, ZBTB8B, ZNF263, ZNF473, PRKCA, ZBTB8A, ZNF263, ZNF473
- Immunogen:
- The immunogen for anti-SOX6 antibody: synthetic peptide directed towards the middle region of human SOX6
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- SOX6 antibody - middle region (ARP39760_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Chicken: 92%; Mouse: 92%; Rat: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-SOX6 antibody
- ARP39760_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: TYGMKTDGGSLAGNEMINGEDEMEMYDDYEDDPKSDYSSENEAPEAVSAN
- Blocking Peptide:
- For anti-SOX6 antibody is Catalog # AAP39760 (Previous Catalog # AAPP21785)
- Key Reference:
- Ikeda,T., (2007) Biochem. Biophys. Res. Commun. 357 (2), 383-390
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-SOX6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: SOX6 antibody tested with Human Fetal Stomach Tissue (ARP39760_P050)
Aviva Systems Biology is the original manufacturer of this SOX6 antibody (ARP39760_P050)
Click here to view the SOX6 antibody Western Blot Protocol
Product Datasheet Link: SOX6 antibody (ARP39760_P050)
WB Suggested Anti-SOX6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Stomach
Western Blot image: 
Description of Target: SOX6 is a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. SOX6 is a trans
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s SOX6 antibody (ARP39760_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


