TSC22D4 antibody - N-terminal region (ARP30107_T100)

Catalog#: ARP30107_T100

• Size: 100ug

Human HepG2

Human kidney

Human Lung

• Description of Target: TSC22D4 is a leucine zipper-containing protein that is highly conserved during evolution. It is transcriptionally up-regulated by many different stimuli, including anti-cancer drugs and growth inhibitors. TSC22D4 may play a suppressive role in tumorigenesis.
• Gene Symbol: TSC22D4
• Official Gene Full Name: TSC22 domain family, member 4
• Alias Symbols: THG1; THG-1; TILZ2
• Protein Accession#: NP_112197
• Nucleotide Accession#: NM_030935
• Swissprot Id: Q9Y3Q8
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 395
• Molecular Weight: 41kDa
• Application: WB, IHC
• Immunogen: The immunogen for anti-TSC22D4 antibody: synthetic peptide directed towards the N terminal of human TSC22D4
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPD
• Blocking Peptide: For anti-TSC22D4 antibody is Catalog # AAP30107 (Previous Catalog # AAPH00283)
• Key Reference: Scherer,S.W., et al., (2003) Science 300 (5620), 767-772
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-TSC22D4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: TSC22D4 antibody tested with Human Hepg2 Cells (ARP30107_T100)

Aviva Systems Biology is the original manufacturer of this TSC22D4 antibody (ARP30107_T100)

Click here to view the TSC22D4 antibody Western Blot Protocol

Product Datasheet Link: TSC22D4 antibody (ARP30107_T100)

WB Suggested Anti-TSC22D4 Antibody Titration: 0.5ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2

Western Blot image:


Description of Target: TSC22D4 is a leucine zipper-containing protein that is highly conserved during evolution. It is transcriptionally up-regulated by many different stimuli, including anti-cancer drugs and growth inhibitors. TSC22D4 may play a suppressive role in tumorigenesis.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TSC22D4 antibody (ARP30107_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: TSC22D4 antibody tested by IHC with human lung (ARP30107)

Aviva Systems Biology is the original manufacturer of this TSC22D4 antibody.

Click here to view the TSC22D4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TSC22D4 antibody (ARP30107)

IHC Information:

Rabbit Anti-TSC22D4 Antibody
Catalog Number: ARP30107
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: TSC22D4 antibody tested by IHC with human kidney (ARP30107)

Aviva Systems Biology is the original manufacturer of this TSC22D4 antibody.

Click here to view the TSC22D4 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: TSC22D4 antibody (ARP30107)

IHC Information:

Rabbit Anti-TSC22D4 Antibody
Catalog Number: ARP30107
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: