- Description of Target:
- The function of this protein remains unknown.
- Gene Symbol:
- Timp2
- Official Gene Full Name:
- Tissue inhibitor of metalloproteinase 2
- Alias Symbols:
- D11Bwg1104e; Timp-2
- Tissue Tool:
- Find tissues and cell lines supported to express Timp2.
- Protein Accession# :
- NP_035724
- Nucleotide Accession#:
- NM_011594
- Swissprot Id:
- Q8BSJ3
- Host:
- Rabbit
- Protein Size (# AA):
- 220
- Molecular Weight:
- 24kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Timp2 antibody - C-terminal region (ARP42116_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; African clawed frog: 92%; Chicken: 92%; Zebrafish: 78%
- Datasheets / Downloads:
- Printable datasheet for
anti-Timp2 antibody
- ARP42116_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: ECLWMDWVTEKSINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
- Blocking Peptide:
- For anti-Timp2 antibody is Catalog # AAP42116
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Timp2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
