MYF6 antibody - N-terminal region (ARP32135_P050)

Catalog#: ARP32135_P050

• Size: 50ug

Human heart

Human Intestine

Human Pancreas

• Description of Target: MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.
• Gene Symbol: MYF6
• Official Gene Full Name: Myogenic factor 6 (herculin)
• Alias Symbols: MRF4; CNM3; myf-6; bHLHc4
• Protein Accession#: NP_002460
• Nucleotide Accession#: NM_002469
• Swissprot Id: P23409
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 242
• Molecular Weight: 27kDa
• Application: WB, IHC
• Partner Proteins: CPSF1, RELA, RXRA, RXRB, TAF1, TAF10, TAF12, TAF13, TAF2, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TBP, TRIM24, GTF2B, GTF2E1, GTF2F1, POLR2A, RELA, TAF13, TAF15, TAF5, TBP, TRIM24
• Immunogen: The immunogen for anti-MYF6 antibody: synthetic peptide directed towards the N terminal of human MYF6
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA
• Blocking Peptide: For anti-MYF6 antibody is Catalog # AAP32135 (Previous Catalog # AAPP03087)
• Key Reference: Roy,K., et al., (2002) J. Biol. Chem. 277 (37), 33818-33824
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-MYF6 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: MYF6 antibody tested with Human Fetal Heart Tissue (ARP32135_P050)

Aviva Systems Biology is the original manufacturer of this MYF6 antibody (ARP32135_P050)

Click here to view the MYF6 antibody Western Blot Protocol

Product Datasheet Link: MYF6 antibody (ARP32135_P050)

WB Suggested Anti-MYF6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Fetal Heart

Western Blot image:


Description of Target: MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s MYF6 antibody (ARP32135_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Protocols: MYF6 antibody tested by IHC with human intestine (ARP32135)

Aviva Systems Biology is the original manufacturer of this MYF6 antibody.

Click here to view the MYF6 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: MYF6 antibody (ARP32135)

IHC Information:

Rabbit Anti-MYF6 Antibody
Catalog Number: ARP32135
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Product Protocols: MYF6 antibody tested by IHC with human pancreas (ARP32135)

Aviva Systems Biology is the original manufacturer of this MYF6 antibody.

Click here to view the MYF6 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: MYF6 antibody (ARP32135)

IHC Information:

Rabbit Anti-MYF6 Antibody
Catalog Number: ARP32135
Paraffin Embedded Tissue: Human Pancreas
Cellular Data: Epithelial cells of pancreatic acinus
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image: