website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100ug
$229.00
In Stock

GAS7 antibody - N-terminal region (ARP30004_T100)

Description of Target:
The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.
Gene Symbol:
GAS7
Official Gene Full Name:
Growth arrest-specific 7
NCBI Gene Id:
8522
Alias Symbols:
MLL/GAS7
Tissue Tool:
Find tissues and cell lines supported to express GAS7.
Protein Accession #:
NP_958839
Nucleotide Accession#:
NM_201433
Swissprot Id:
Q7Z571
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Growth arrest-specific protein 7
Protein Size (# AA):
476
Molecular Weight:
54kDa
Application:
IHC, WB
Partner Proteins:
BCL10, CYLD, IKBKB, IKBKG, PRKCQ, TAB3, TANK, TRAF3IP2, TRAF3IP2, UBB, ZFAND5, tax, BCL10, BIRC3, CARD10, CARD11, CARD8, CASP8, CDC37, CHUK, COPS3, CREBBP, CYLD, FADD, GSK3B, HSP90AA1, HSP90AB1, HSPA1A, HSPA4, IKBKB, IKBKG, MAP3K14, NCOA3, NFKB1, NFKB2, NFKBIA, NFKBIB, PPM1B, PRKCQ, RAB11B, RAL
Immunogen:
The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7
Product Format:
Lyophilized powder
Purification:
Protein A purified
Complete computational species homology data:
GAS7 antibody - N-terminal region (ARP30004_T100)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%
Species Reactivity:
Human, Bovine, Dog, Horse, Rabbit, Rat, Guinea pig, Mouse
Datasheets / Downloads:
Printable datasheet for
anti-GAS7 antibody
- ARP30004_T100
Peptide Sequence:
Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Blocking Peptide:
For anti-GAS7 antibody is Catalog # AAP30004 (Previous Catalog # AAPH00104)
Key Reference:
Ju,Y.T., et al., (1998) Proc. Natl. Acad. Sci. U.S.A. 95 (19), 11423-11428
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-GAS7 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question