- Description of Target:
- ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
- Gene Symbol:
- ZNF496
- Official Gene Full Name:
- Zinc finger protein 496
- Alias Symbols:
- MGC15548; NIZP1; ZKSCAN17; ZFP496
- Tissue Tool:
- Find tissues and cell lines supported to express ZNF496.
- Protein Accession# :
- NP_116141
- Nucleotide Accession#:
- NM_032752
- Swissprot Id:
- Q96IT1
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 587
- Molecular Weight:
- 67kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-ZNF496 antibody: synthetic peptide directed towards the middle region of human ZNF496
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- ZNF496 antibody - middle region (ARP30024_P050)
- Predicted Homology Based on Immunogen Sequence:
- Dog: 92%; Pig: 92%; Bovine: 85%; Horse: 85%; Sheep: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-ZNF496 antibody
- ARP30024_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: QEKPHECSVCGELFSDSEDLDGHLESHEAQKPYRCGACGKSFRLNSHLLS
- Blocking Peptide:
- For anti-ZNF496 antibody is Catalog # AAP30024 (Previous Catalog # AAPH00124)
- Key Reference:
- Nielsen,A.L., (2004) Mol. Cell. Biol. 24 (12), 5184-5196
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-ZNF496 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: ZNF496 antibody tested with Human Panc1 Cells (ARP30024_P050)
Aviva Systems Biology is the original manufacturer of this ZNF496 antibody (ARP30024_P050)
Click here to view the ZNF496 antibody Western Blot Protocol
Product Datasheet Link: ZNF496 antibody (ARP30024_P050)
WB Suggested Anti-ZNF496 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: PANC1
Western Blot image: 
Description of Target: ZNF496 contains a SCAN box, a KRAB-A domain, and four consensus C2H2-type zinc fingers preceded by a unique finger derivative, referred to herein as the C2HR motif. The C2HR motif functions to mediate protein-protein interaction with the cysteine-rich (C5HCH) domain of NSD1 in a Zn(II)-dependent fashion, and when tethered to RNA polymerase II promoters, represses transcription in an NSD1-dependent manner. ZNF496 contains a novel type of zinc finger motif that functions as a docking site for NSD1 and is more than just a degenerate evolutionary remnant of a C2H2 motif.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s ZNF496 antibody (ARP30024_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
