- Description of Target:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
- Gene Symbol:
- CYP2A7
- Official Gene Full Name:
- Cytochrome P450, family 2, subfamily A, polypeptide 7
- Alias Symbols:
- CPA7; CPAD; CYP2A; CYPIIA7; P450-IIA4
- Tissue Tool:
- Find tissues and cell lines supported to express CYP2A7.
- Protein Accession# :
- NP_000755
- Nucleotide Accession#:
- NM_172058
- Swissprot Id:
- P20853
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 494
- Molecular Weight:
- 56kDa
- Application:
- WB
- Immunogen:
- The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- CYP2A7 antibody - middle region (ARP41800_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Dog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-CYP2A7 antibody
- ARP41800_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI
- Blocking Peptide:
- For anti-CYP2A7 antibody is Catalog # AAP41800 (Previous Catalog # AAPY01923)
- Key Reference:
- Orten,D.J., (2008) Hum. Mutat. 29 (4), 537-544
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-CYP2A7 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: CYP2A7 antibody tested with Human Achn Cells (ARP41800_P050)
Aviva Systems Biology is the original manufacturer of this CYP2A7 antibody (ARP41800_P050)
Click here to view the CYP2A7 antibody Western Blot Protocol
Product Datasheet Link: CYP2A7 antibody (ARP41800_P050)
WB Suggested Anti-CYP2A7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: ACHN
Western Blot image: 
Description of Target: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein local
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s CYP2A7 antibody (ARP41800_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
