CALR antibody - C-terminal region (ARP30114_P050)

Catalog#: ARP30114_P050

• Size: 50ug

Human HepG2

• Description of Target: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium.
• Gene Symbol: CALR
• Official Gene Full Name: Calreticulin
• Alias Symbols: RO; CRT; SSA; cC1qR
• Protein Accession#: NP_004334
• Nucleotide Accession#: NM_004343
• Swissprot Id: P27797
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 417
• Molecular Weight: 48kDa
• Application: WB
• Partner Proteins: C20orf20, MLLT10, NUMA1, PFDN1, SMARCB1, TACC1, TACC2, TFAP2B, ING3, KIAA1009, MLLT10, NUMA1, PFDN1, RUVBL1, RUVBL2, SMARCB1, TACC1, TACC2
• Immunogen: The immunogen for anti-CALR antibody: synthetic peptide directed towards the C terminal of human CALR
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Mouse: 100%; Rat: 100%; Pig: 92%; Rabbit: 92%; Zebrafish: 78%; African clawed frog: 76%
• Peptide Sequence: Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK
• Blocking Peptide: For anti-CALR antibody is Catalog # AAP30114 (Previous Catalog # AAPH00290)
• Key Reference: Urade,R., et al., (2004) Biochemistry 43 (27), 8858-8868
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-CALR antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: CALR antibody tested with Human Hepg2 Cells (ARP30114_P050)

Aviva Systems Biology is the original manufacturer of this CALR antibody (ARP30114_P050)

Click here to view the CALR antibody Western Blot Protocol

Product Datasheet Link: CALR antibody (ARP30114_P050)

WB Suggested Anti-CALR Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:


Description of Target: Calreticulin is a multifunctional protein that acts as a major Ca(2+)-binding (storage) protein in the lumen of the endoplasmic reticulum. It is also found in the nucleus, suggesting that it may have a role in transcription regulation. Calreticulin binds to the synthetic peptide KLGFFKR, which is almost identical to an amino acid sequence in the DNA-binding domain of the superfamily of nuclear receptors. Calreticulin binds to antibodies in certain sera of systemic lupus and Sjogren patients which contain anti-Ro/SSA antibodies, it is highly conserved among species, and it is located in the endoplasmic and sarcoplasmic reticulum where it may bind calcium.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CALR antibody (ARP30114_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com