website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

POU6F1 antibody - middle region (ARP31433_P050)

Description of Target:
The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.
Gene Symbol:
Official Gene Full Name:
POU class 6 homeobox 1
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express POU6F1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express POU6F1.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
POU domain, class 6, transcription factor 1
Protein Size (# AA):
Molecular Weight:
The immunogen is a synthetic peptide directed towards the middle region of human POU6F1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-POU6F1 (ARP31433_P050)
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Species Reactivity:
Cow; Dog; Horse; Human; Mouse; Rabbit; Rat; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-POU6F1 (ARP31433_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Blocking Peptide:
For anti-POU6F1 (ARP31433_P050) antibody is Catalog # AAP31433 (Previous Catalog # AAPP02191)
Target Reference:
Wey,E., et al., (1994) J. Biochem. 220 (3), 753-762
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: POU6F1 antibody tested with Human Fetal Kidney Nuclear Extract (ARP31433_P050)

Aviva Systems Biology is the original manufacturer of this POU6F1 antibody (ARP31433_P050)

Click here to view the POU6F1 antibody Western Blot Protocol

Product Datasheet Link: POU6F1 antibody (ARP31433_P050)

WB Suggested Anti-POU6F1 Antibody Titration: 0.12ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal kidney nuclear extract

Western Blot image:

Description of Target: The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s POU6F1 antibody (ARP31433_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: POU6F1 antibody tested by IHC with human intestine (ARP31433)

Aviva Systems Biology is the original manufacturer of this POU6F1 antibody.

Click here to view the POU6F1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: POU6F1 antibody (ARP31433)

IHC Information:

Rabbit Anti-POU6F1 Antibody
Catalog Number: ARP31433
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question