website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

POU6F1 antibody - middle region (ARP31433_P050)

Description of Target:
The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.
Gene Symbol:
Official Gene Full Name:
POU class 6 homeobox 1
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express POU6F1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
POU domain, class 6, transcription factor 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-POU6F1 antibody: synthetic peptide directed towards the middle region of human POU6F1
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
POU6F1 antibody - middle region (ARP31433_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 92%
Species Reactivity:
Human, Bovine, Dog, Horse, Rabbit, Rat, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-POU6F1 antibody
- ARP31433_P050
Peptide Sequence:
Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Blocking Peptide:
For anti-POU6F1 antibody is Catalog # AAP31433 (Previous Catalog # AAPP02191)
Key Reference:
Wey,E., et al., (1994) J. Biochem. 220 (3), 753-762
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-POU6F1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question