website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

POU6F1 antibody - middle region (ARP31433_P050)

Description of Target:
The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.
Gene Symbol:
Official Gene Full Name:
POU class 6 homeobox 1
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express POU6F1.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
POU domain, class 6, transcription factor 1
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-POU6F1 antibody: synthetic peptide directed towards the middle region of human POU6F1
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
POU6F1 antibody - middle region (ARP31433_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 92%
Species Reactivity:
Human, Bovine, Dog, Horse, Rabbit, Rat, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-POU6F1 antibody
- ARP31433_P050
Peptide Sequence:
Synthetic peptide located within the following region: YFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSKLNVFQIP
Blocking Peptide:
For anti-POU6F1 antibody is Catalog # AAP31433 (Previous Catalog # AAPP02191)
Target Reference:
Wey,E., et al., (1994) J. Biochem. 220 (3), 753-762
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for POU6F1 antibody (ARP31433)

Product page for POU6F1 antibody (ARP31433)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant POU6F1 antibody; Loxodonta africana POU6F1 antibody G3U0L3 100%
African elephant POU6F1 antibody; Loxodonta africana POU6F1 antibody G3TLG0 100%
Bovine POU6F1 antibody; Bos taurus POU6F1 antibody E1BPZ0 100%
Dog POU6F1 antibody; Canis familiaris POU6F1 antibody E2R3Z5 100%
Duckbill platypus POU6F1 antibody; Ornithorhynchus anatinus POU6F1 antibody F6W8F3 92%
Duckbill platypus POU6F1 antibody; Ornithorhynchus anatinus POU6F1 antibody F6W8E3 92%
Giant panda POU6F1 antibody; Ailuropoda melanoleuca POU6F1 antibody G1L5P8 100%
Green anole POU6F1 antibody; Anolis carolinensis POU6F1 antibody G1KM22 100%
Horse LOC100052561 antibody; Equus caballus LOC100052561 antibody F6WRV8 100%
Human PO6F1 antibody; Homo sapiens PO6F1 antibody Q14863 100%
Human POU6F1 antibody; Homo sapiens POU6F1 antibody Q3B832 100%
Little brown bat POU6F1 antibody; Myotis lucifugus POU6F1 antibody G1PEV2 100%
Lowland gorilla POU6F1 antibody; Gorilla gorilla gorilla POU6F1 antibody G3QDB3 100%
Mouse PO6F1 antibody; Mus musculus PO6F1 antibody Q07916 100%
Mouse PO6F1 antibody; Mus musculus PO6F1 antibody Q07916-3 100%
Mouse PO6F1 antibody; Mus musculus PO6F1 antibody Q07916-2 100%
Mouse Pou6f1 antibody; Mus musculus Pou6f1 antibody Q6X2S0 100%
Mouse Pou6f1 antibody; Mus musculus Pou6f1 antibody Q5U4D4 100%
Northern white-cheeked gibbon POU6F1 antibody; Nomascus leucogenys POU6F1 antibody G1S7U9 100%
Rabbit POU6F1 antibody; Oryctolagus cuniculus POU6F1 antibody G1T4Y3 100%
Rat PO6F1 antibody; Rattus norvegicus PO6F1 antibody P56223 100%
Rat Pou6f1 antibody; Rattus norvegicus Pou6f1 antibody F1LQJ6 100%
Rat Pou6f1 antibody; Rattus norvegicus Pou6f1 antibody D3ZUB6 100%
Rhesus macaque LOC694640 antibody; Macaca mulatta LOC694640 antibody F6RQJ9 100%
Small-eared galago POU6F1 antibody; Otolemur garnettii POU6F1 antibody H0WXF9 100%
Tasmanian devil POU6F1 antibody; Sarcophilus harrisii POU6F1 antibody G3VME4 100%
Three-spined stickleback POU6F1 antibody; Gasterosteus aculeatus POU6F1 antibody G3PA30 92%
Western clawed frog pou6f1 antibody; Xenopus tropicalis pou6f1 antibody F7C2Q1 100%
Western clawed frog pou6f1 antibody; Xenopus tropicalis pou6f1 antibody F6UEA5 100%
Western clawed frog pou6f1 antibody; Xenopus tropicalis pou6f1 antibody A8E4V1 100%
White-tufted-ear marmoset LOC100387512 antibody; Callithrix jacchus LOC100387512 antibody F7H915 100%
White-tufted-ear marmoset LOC100387512 antibody; Callithrix jacchus LOC100387512 antibody F7GR72 100%
Zebrafish PO6F1 antibody; Danio rerio PO6F1 antibody P31367 92%

Product Protocols: POU6F1 antibody tested with Human Fetal Kidney Nuclear Extract (ARP31433_P050)

Aviva Systems Biology is the original manufacturer of this POU6F1 antibody (ARP31433_P050)

Click here to view the POU6F1 antibody Western Blot Protocol

Product Datasheet Link: POU6F1 antibody (ARP31433_P050)

WB Suggested Anti-POU6F1 Antibody Titration: 0.12ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal kidney nuclear extract

Western Blot image:

Description of Target: The POU6F1 gene encodes a protein that is part of a family of transcription factors which exhibit distinct temporal and spatial patterns of expression.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s POU6F1 antibody (ARP31433_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: POU6F1 antibody tested by IHC with human intestine (ARP31433)

Aviva Systems Biology is the original manufacturer of this POU6F1 antibody.

Click here to view the POU6F1 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: POU6F1 antibody (ARP31433)

IHC Information:

Rabbit Anti-POU6F1 Antibody
Catalog Number: ARP31433
Paraffin Embedded Tissue: Human Intestine
Cellular Data: Epithelial cells of intestinal villas
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question