PAX2 Antibody - middle region (ARP31220_P050)

Catalog#: ARP31220_P050

• Size: 50ug

Human MCF7

• Description of Target: PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia.
• Gene Symbol: PAX2
• Alias Symbols: -
• Protein Accession#: NP_000269
• Nucleotide Accession#: NM_000278
• Swissprot Id: G3V5U4
• Host: Rabbit
• Protein Size (# AA): 393
• Molecular Weight: 42kDa
• Application: WB
• Partner Proteins: ID2,MAPK8,MAPK8IP1,PAXIP1,RB1,SFRP2,WT1,MAPK8,MAPK8IP1,PAXIP1
• Immunogen: The immunogen for Anti-PAX2 antibody is: synthetic peptide directed towards the middle region of Human PAX2
• Product Format: Lyophilized powder
• Peptide Sequence: Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR
• Blocking Peptide: Catalog # AAP31220
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final Anti-PAX2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.