website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

KCNIP2 antibody - middle region (ARP35490_P050)

Description of Target:
The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Gene Symbol:
KCNIP2
Official Gene Full Name:
Kv channel interacting protein 2
NCBI Gene Id:
30819
Alias Symbols:
DKFZp566L1246; KCHIP2; MGC17241
Tissue Tool:
Find tissues and cell lines supported to express KCNIP2.
Protein Accession #:
NP_775283
Nucleotide Accession#:
NM_173191
Swissprot Id:
Q9NS61
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Kv channel-interacting protein 2
Protein Size (# AA):
270
Molecular Weight:
31kDa
Application:
WB
Partner Proteins:
KCND2, KCND3, KCNIP4
Immunogen:
The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the middle region of human KCNIP2
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
KCNIP2 antibody - middle region (ARP35490_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Species Reactivity:
Pig, Human, Bovine, Rat, Mouse, Dog, Horse, Rabbit, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-KCNIP2 antibody
- ARP35490_P050
Peptide Sequence:
Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH
Blocking Peptide:
For anti-KCNIP2 antibody is Catalog # AAP35490 (Previous Catalog # AAPP07285)
Key Reference:
Han,W., (2006) J. Biol. Chem. 281 (37), 27134-27144
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-KCNIP2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question