website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

KCNIP2 antibody - middle region (ARP35490_P050)

Description of Target:
The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Gene Symbol:
KCNIP2
Official Gene Full Name:
Kv channel interacting protein 2
NCBI Gene Id:
30819
Alias Symbols:
DKFZp566L1246; KCHIP2; MGC17241
Tissue Tool:
Find tissues and cell lines supported to express KCNIP2.
Protein Accession #:
NP_775283
Nucleotide Accession#:
NM_173191
Swissprot Id:
Q9NS61
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Kv channel-interacting protein 2
Protein Size (# AA):
270
Molecular Weight:
31kDa
Application:
WB
Protein Interactions:
KCND2; KCNIP1; KCNIP2; KCNE4; KCND3; KCNIP4;
Immunogen:
The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the middle region of human KCNIP2
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
KCNIP2 antibody - middle region (ARP35490_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Species Reactivity:
Pig, Human, Bovine, Rat, Mouse, Dog, Horse, Rabbit, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-KCNIP2 antibody
- ARP35490_P050
Peptide Sequence:
Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH
Blocking Peptide:
For anti-KCNIP2 antibody is Catalog # AAP35490 (Previous Catalog # AAPP07285)
Target Reference:
Han,W., (2006) J. Biol. Chem. 281 (37), 27134-27144
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: KCNIP2 antibody tested with Human Fetal Stomach Tissue (ARP35490_P050)

Aviva Systems Biology is the original manufacturer of this KCNIP2 antibody (ARP35490_P050)

Click here to view the KCNIP2 antibody Western Blot Protocol

Product Datasheet Link: KCNIP2 antibody (ARP35490_P050)

WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Stomach

Western Blot image:


Description of Target: The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s KCNIP2 antibody (ARP35490_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question