website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

KCNIP2 antibody - middle region (ARP35490_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    NCBI Gene Id:
    Official Gene Full Name:
    Kv channel interacting protein 2
    Protein Name:
    Kv channel-interacting protein 2
    Swissprot Id:
    Protein Accession #:
    Nucleotide Accession #:
    Alias Symbols:
    DKFZp566L1246, KCHIP2, MGC17241
    Description of Target:
    The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
    Protein Size (# AA):
    Molecular Weight:
    Affinity Purified
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express KCNIP2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express KCNIP2.
    The immunogen is a synthetic peptide directed towards the middle region of human KCNIP2
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
    Complete computational species homology data:
    Anti-KCNIP2 (ARP35490_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    Blocking Peptide:
    For anti-KCNIP2 (ARP35490_P050) antibody is Catalog # AAP35490 (Previous Catalog # AAPP07285)
    Datasheets / Downloads:
    Printable datasheet for anti-KCNIP2 (ARP35490_P050) antibody
    Target Reference:
    Han,W., (2006) J. Biol. Chem. 281 (37), 27134-27144

    Product Protocols: KCNIP2 antibody tested with Human Fetal Stomach Tissue (ARP35490_P050)

    Aviva Systems Biology is the original manufacturer of this KCNIP2 antibody (ARP35490_P050)

    Click here to view the KCNIP2 antibody Western Blot Protocol

    Product Datasheet Link: KCNIP2 antibody (ARP35490_P050)

    WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Fetal Stomach

    Western Blot image:

    Description of Target: The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.

    Questions pertaining to this data can be directed to

    Aviva Systems Biology’s KCNIP2 antibody (ARP35490_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

    Ask a Question