website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

KCNIP2 antibody - middle region (ARP35490_P050)

Description of Target:
The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
Gene Symbol:
Official Gene Full Name:
Kv channel interacting protein 2
NCBI Gene Id:
Alias Symbols:
DKFZp566L1246; KCHIP2; MGC17241
Tissue Tool:
Find tissues and cell lines supported to express KCNIP2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Kv channel-interacting protein 2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the middle region of human KCNIP2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
KCNIP2 antibody - middle region (ARP35490_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Species Reactivity:
Pig, Human, Bovine, Rat, Mouse, Dog, Horse, Rabbit, Guinea pig, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-KCNIP2 antibody
- ARP35490_P050
Peptide Sequence:
Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH
Blocking Peptide:
For anti-KCNIP2 antibody is Catalog # AAP35490 (Previous Catalog # AAPP07285)
Target Reference:
Han,W., (2006) J. Biol. Chem. 281 (37), 27134-27144
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-KCNIP2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for KCNIP2 antibody (ARP35490)

Product page for KCNIP2 antibody (ARP35490)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog kcnip1 antibody; Xenopus laevis kcnip1 antibody Q6GM25 78%
African clawed frog kcnip2 antibody; Xenopus laevis kcnip2 antibody Q640X4 78%
African clawed frog kcnip4 antibody; Xenopus laevis kcnip4 antibody Q4V7N5 78%
African elephant KCNIP1 antibody; Loxodonta africana KCNIP1 antibody G3THM5 78%
African elephant KCNIP2 antibody; Loxodonta africana KCNIP2 antibody G3U6B6 100%
African elephant KCNIP2 antibody; Loxodonta africana KCNIP2 antibody G3TGA0 100%
African elephant KCNIP4 antibody; Loxodonta africana KCNIP4 antibody G3SWW8 78%
Bovine BT.24395 antibody; Bos taurus BT.24395 antibody F1N410 100%
Bovine KCNIP1 antibody; Bos taurus KCNIP1 antibody Q5BN37 78%
Bovine KCNIP1 antibody; Bos taurus KCNIP1 antibody E1BPJ9 78%
Bovine KCNIP2 antibody; Bos taurus KCNIP2 antibody A6QPA9 100%
Chicken KCNIP1 antibody; Gallus gallus KCNIP1 antibody E1BY23 78%
Chicken KCNIP2 antibody; Gallus gallus KCNIP2 antibody Q8JFP6 100%
Chicken KCNIP2 antibody; Gallus gallus KCNIP2 antibody F1NUT4 100%
Chicken KCNIP2 antibody; Gallus gallus KCNIP2 antibody E1BVQ2 100%
Chicken KCNIP4 antibody; Gallus gallus KCNIP4 antibody Q8JFP5 78%
Chicken KCNIP4 antibody; Gallus gallus KCNIP4 antibody Q4F8N1 78%
Chicken KCNIP4 antibody; Gallus gallus KCNIP4 antibody F1NY68 78%
Chicken KCNIP4 antibody; Gallus gallus KCNIP4 antibody F1NR78 78%
Chicken KCNIP4 antibody; Gallus gallus KCNIP4 antibody F1NHH8 78%
Chicken KCNIP4 antibody; Gallus gallus KCNIP4 antibody E1C338 78%
Chinese hamster LOC100753351 antibody; Cricetulus griseus LOC100753351 antibody G3HXV0 100%
Common turkey KCNIP1 antibody; Meleagris gallopavo KCNIP1 antibody G1MSM6 78%
Common turkey KCNIP2 antibody; Meleagris gallopavo KCNIP2 antibody G5E7R0 100%
Common turkey KCNIP2 antibody; Meleagris gallopavo KCNIP2 antibody G1NCF4 100%
Common turkey KCNIP4 antibody; Meleagris gallopavo KCNIP4 antibody G1NIR4 78%
Common turkey LOC100542787 antibody; Meleagris gallopavo LOC100542787 antibody G1NIR3 78%
Crab-eating macaque KCIP4 antibody; Macaca fascicularis KCIP4 antibody Q8HYN7 78%
Dog KCNIP2 antibody; Canis familiaris KCNIP2 antibody F1PH04 100%
Dog KCNIP4 antibody; Canis familiaris KCNIP4 antibody F1P9R0 78%
Dog KCNIP4 antibody; Canis familiaris KCNIP4 antibody E2QYT3 78%
Duckbill platypus KCNIP1 antibody; Ornithorhynchus anatinus KCNIP1 antibody F6Y1G7 78%
Duckbill platypus KCNIP1 antibody; Ornithorhynchus anatinus KCNIP1 antibody F6Y1F6 78%
Duckbill platypus KCNIP4 antibody; Ornithorhynchus anatinus KCNIP4 antibody F6WE06 85%
Duckbill platypus KCNIP4 antibody; Ornithorhynchus anatinus KCNIP4 antibody F6WDY9 85%
Duckbill platypus LOC100081464 antibody; Ornithorhynchus anatinus LOC100081464 antibody F6WE17 85%
European domestic ferret KCIP2 antibody; Mustela putorius furo KCIP2 antibody Q8WN03 100%
European domestic ferret KCIP2 antibody; Mustela putorius furo KCIP2 antibody Q8WN03-3 100%
European domestic ferret KCIP2 antibody; Mustela putorius furo KCIP2 antibody Q8WN03-2 100%
Gray short-tailed opossum KCNIP1 antibody; Monodelphis domestica KCNIP1 antibody F6PG87 85%
Gray short-tailed opossum KCNIP2 antibody; Monodelphis domestica KCNIP2 antibody F6TJR9 100%
Gray short-tailed opossum KCNIP2 antibody; Monodelphis domestica KCNIP2 antibody F6TJA6 100%
Gray short-tailed opossum KCNIP2 antibody; Monodelphis domestica KCNIP2 antibody F6TJ61 100%
Gray short-tailed opossum KCNIP3 antibody; Monodelphis domestica KCNIP3 antibody F7CLG3 76%
Gray short-tailed opossum LOC100023320 antibody; Monodelphis domestica LOC100023320 antibody F7CRA8 100%
Gray short-tailed opossum LOC100023320 antibody; Monodelphis domestica LOC100023320 antibody F6TJ89 100%
Gray short-tailed opossum LOC100026341 antibody; Monodelphis domestica LOC100026341 antibody F6PG97 85%
Green anole KCNIP1 antibody; Anolis carolinensis KCNIP1 antibody G1KRS7 84%
Green anole KCNIP4 antibody; Anolis carolinensis KCNIP4 antibody G1K989 78%
Guinea pig KCNIP1 antibody; Cavia porcellus KCNIP1 antibody H0VQP9 84%
Guinea pig KCNIP2 antibody; Cavia porcellus KCNIP2 antibody H0UUM6 100%
Guinea pig LOC100722651 antibody; Cavia porcellus LOC100722651 antibody H0VKA4 100%
Horse KCNIP1 antibody; Equus caballus KCNIP1 antibody F7BLD5 78%
Horse KCNIP2 antibody; Equus caballus KCNIP2 antibody F6RL19 100%
Horse KCNIP2 antibody; Equus caballus KCNIP2 antibody F6PIV3 100%
Horse LOC100147377 antibody; Equus caballus LOC100147377 antibody F7DKJ5 78%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61 100%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61-9 100%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61-7 100%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61-6 100%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61-5 100%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61-4 100%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61-3 100%
Human KCIP2 antibody; Homo sapiens KCIP2 antibody Q9NS61-2 100%
Human KCIP4 antibody; Homo sapiens KCIP4 antibody Q6PIL6 78%
Human KCIP4 antibody; Homo sapiens KCIP4 antibody Q6PIL6-4 78%
Human KCIP4 antibody; Homo sapiens KCIP4 antibody Q6PIL6-3 78%
Human KCIP4 antibody; Homo sapiens KCIP4 antibody Q6PIL6-2 78%
Human KCNIP2 antibody; Homo sapiens KCNIP2 antibody Q3YAC7 100%
Human KCNIP2 antibody; Homo sapiens KCNIP2 antibody Q3YAC6 100%
Human KCNIP2 antibody; Homo sapiens KCNIP2 antibody Q09MK0 100%
Human KCNIP2 antibody; Homo sapiens KCNIP2 antibody B3KSZ5 100%
Human KCNIP2 antibody; Homo sapiens KCNIP2 antibody A6NN12 100%
Human KCNIP2 antibody; Homo sapiens KCNIP2 antibody A6NFF4 100%
Human KCNIP4 antibody; Homo sapiens KCNIP4 antibody Q3YAC2 78%
Human KCNIP4 antibody; Homo sapiens KCNIP4 antibody Q3YAC1 78%
Human KCNIP4 antibody; Homo sapiens KCNIP4 antibody Q3YAC0 78%
Human KCNIP4 antibody; Homo sapiens KCNIP4 antibody Q3YAB9 78%
Human KCNIP4 antibody; Homo sapiens KCNIP4 antibody Q3YAB8 78%
Human KCNIP4 antibody; Homo sapiens KCNIP4 antibody Q3YAB7 78%
Human KCNIP4 antibody; Homo sapiens KCNIP4 antibody A8K4N3 78%
Little brown bat KCNIP1 antibody; Myotis lucifugus KCNIP1 antibody G1P9U8 78%
Little brown bat KCNIP2 antibody; Myotis lucifugus KCNIP2 antibody G1P3N8 92%
Lowland gorilla KCNIP2 antibody; Gorilla gorilla gorilla KCNIP2 antibody G3QUJ2 100%
Mouse KCIP1 antibody; Mus musculus KCIP1 antibody Q9JJ57 78%
Mouse KCIP1 antibody; Mus musculus KCIP1 antibody Q9JJ57-4 78%
Mouse KCIP1 antibody; Mus musculus KCIP1 antibody Q9JJ57-3 78%
Mouse KCIP1 antibody; Mus musculus KCIP1 antibody Q9JJ57-2 78%
Mouse KCIP2 antibody; Mus musculus KCIP2 antibody Q9JJ69 100%
Mouse KCIP2 antibody; Mus musculus KCIP2 antibody Q9JJ69-4 100%
Mouse KCIP2 antibody; Mus musculus KCIP2 antibody Q9JJ69-3 100%
Mouse KCIP2 antibody; Mus musculus KCIP2 antibody Q9JJ69-2 100%
Mouse KCIP4 antibody; Mus musculus KCIP4 antibody Q6PHZ8 78%
Mouse KCIP4 antibody; Mus musculus KCIP4 antibody Q6PHZ8-4 78%
Mouse KCIP4 antibody; Mus musculus KCIP4 antibody Q6PHZ8-3 78%
Mouse KCIP4 antibody; Mus musculus KCIP4 antibody Q6PHZ8-2 78%
Mouse Kcnip1 antibody; Mus musculus Kcnip1 antibody Q3YAB6 78%
Mouse Kcnip1 antibody; Mus musculus Kcnip1 antibody Q3YAB5 78%
Mouse Kcnip1 antibody; Mus musculus Kcnip1 antibody Q3YAB4 78%
Mouse Kcnip2 antibody; Mus musculus Kcnip2 antibody Q3YAB3 100%
Mouse Kcnip2 antibody; Mus musculus Kcnip2 antibody Q3YAB2 100%
Mouse Kcnip2 antibody; Mus musculus Kcnip2 antibody Q3YAB1 100%
Mouse Kcnip2 antibody; Mus musculus Kcnip2 antibody Q3YAA4 100%
Mouse Kcnip2 antibody; Mus musculus Kcnip2 antibody F7BWB2 100%
Mouse Kcnip2 antibody; Mus musculus Kcnip2 antibody E9QNK8 100%
Mouse Kcnip2 antibody; Mus musculus Kcnip2 antibody E0CX94 100%
Mouse Kcnip4 antibody; Mus musculus Kcnip4 antibody Q3YAA8 78%
Mouse Kcnip4 antibody; Mus musculus Kcnip4 antibody Q3YAA7 78%
Mouse Kcnip4 antibody; Mus musculus Kcnip4 antibody Q3YAA6 78%
Mouse Kcnip4 antibody; Mus musculus Kcnip4 antibody Q3YAA5 78%
Mouse Kcnip4 antibody; Mus musculus Kcnip4 antibody Q3V060 78%
Mouse Kcnip4 antibody; Mus musculus Kcnip4 antibody Q3UFC0 78%
Northern white-cheeked gibbon KCNIP2 antibody; Nomascus leucogenys KCNIP2 antibody G1RY67 100%
Northern white-cheeked gibbon KCNIP2 antibody; Nomascus leucogenys KCNIP2 antibody G1RY66 100%
Northern white-cheeked gibbon KCNIP2 antibody; Nomascus leucogenys KCNIP2 antibody G1RY59 100%
Northern white-cheeked gibbon KCNIP2 antibody; Nomascus leucogenys KCNIP2 antibody G1RY56 100%
Northern white-cheeked gibbon KCNIP4 antibody; Nomascus leucogenys KCNIP4 antibody G1S470 78%
Northern white-cheeked gibbon LOC100583998 antibody; Nomascus leucogenys LOC100583998 antibody G1S469 78%
Pig KCNIP1 antibody; Sus scrofa KCNIP1 antibody Q5BMD3 78%
Pig KCNIP1 antibody; Sus scrofa KCNIP1 antibody F1RRX7 78%
Pig KCNIP2 antibody; Sus scrofa KCNIP2 antibody F6Q263 100%
Pig LOC100037948 antibody; Sus scrofa LOC100037948 antibody F1S8T5 100%
Rabbit KCNIP1 antibody; Oryctolagus cuniculus KCNIP1 antibody G1TVW6 78%
Rabbit KCNIP1 antibody; Oryctolagus cuniculus KCNIP1 antibody G1SDI3 78%
Rabbit KCNIP2 antibody; Oryctolagus cuniculus KCNIP2 antibody Q2N0M8 100%
Rabbit KCNIP4 antibody; Oryctolagus cuniculus KCNIP4 antibody G1SH06 78%
Rat KCIP1 antibody; Rattus norvegicus KCIP1 antibody Q8R426 78%
Rat KCIP1 antibody; Rattus norvegicus KCIP1 antibody Q8R426-2 78%
Rat KCIP2 antibody; Rattus norvegicus KCIP2 antibody Q9JM59 100%
Rat KCIP2 antibody; Rattus norvegicus KCIP2 antibody Q9JM59-3 100%
Rat KCIP2 antibody; Rattus norvegicus KCIP2 antibody Q9JM59-2 100%
Rat KCIP4 antibody; Rattus norvegicus KCIP4 antibody Q99MG9 78%
Rat KCIP4 antibody; Rattus norvegicus KCIP4 antibody Q99MG9-2 78%
Rat Kcnip1 antibody; Rattus norvegicus Kcnip1 antibody F1M8N6 78%
Rat Kcnip2 antibody; Rattus norvegicus Kcnip2 antibody D5LL09 100%
Rat Kcnip2 antibody; Rattus norvegicus Kcnip2 antibody D4AA95 100%
Rat Kcnip2 antibody; Rattus norvegicus Kcnip2 antibody D3ZEE1 100%
Rat Kcnip4 antibody; Rattus norvegicus Kcnip4 antibody G3V9C1 78%
Rhesus macaque KCNIP2 antibody; Macaca mulatta KCNIP2 antibody F6QI81 100%
Rhesus macaque KCNIP4 antibody; Macaca mulatta KCNIP4 antibody F7EPS3 78%
Rhesus macaque KCNIP4 antibody; Macaca mulatta KCNIP4 antibody F7EPR7 78%
Rhesus macaque Mmu.18820 antibody; Macaca mulatta Mmu.18820 antibody F7AWP5 100%
Rhesus macaque Mmu.18820 antibody; Macaca mulatta Mmu.18820 antibody F7AWN8 100%
Rhesus macaque Mmu.18820 antibody; Macaca mulatta Mmu.18820 antibody F6QI88 100%
Rhesus macaque Mmu.18820 antibody; Macaca mulatta Mmu.18820 antibody F6QI40 100%
Rhesus macaque Mmu.18820 antibody; Macaca mulatta Mmu.18820 antibody F6QI25 100%
Small-eared galago KCNIP1 antibody; Otolemur garnettii KCNIP1 antibody H0X9F3 78%
Small-eared galago KCNIP2 antibody; Otolemur garnettii KCNIP2 antibody H0X1Q4 92%
Small-eared galago KCNIP4 antibody; Otolemur garnettii KCNIP4 antibody H0X7U2 78%
Spotted green pufferfish KCNIP3 (1 of 2) antibody; Tetraodon nigroviridis KCNIP3 (1 of 2) antibody Q4SJ94 76%
Sumatran orangutan KCNIP4 antibody; Pongo abelii KCNIP4 antibody Q5RDR0 84%
Tasmanian devil KCNIP1 antibody; Sarcophilus harrisii KCNIP1 antibody G3X3U4 85%
Tasmanian devil KCNIP1 antibody; Sarcophilus harrisii KCNIP1 antibody G3X3U3 85%
Tasmanian devil KCNIP3 antibody; Sarcophilus harrisii KCNIP3 antibody G3W624 76%
Tasmanian devil KCNIP4 antibody; Sarcophilus harrisii KCNIP4 antibody G3X0N3 78%
Tasmanian devil KCNIP4 antibody; Sarcophilus harrisii KCNIP4 antibody G3X0N2 78%
Three-spined stickleback KCNIP1 (1 of 2) antibody; Gasterosteus aculeatus KCNIP1 (1 of 2) antibody G3Q176 78%
Three-spined stickleback KCNIP3 (1 of 2) antibody; Gasterosteus aculeatus KCNIP3 (1 of 2) antibody G3NQD3 76%
Three-spined stickleback KCNIP3 (1 of 2) antibody; Gasterosteus aculeatus KCNIP3 (1 of 2) antibody G3NQC7 76%
Three-spined stickleback KCNIP3 (2 of 2) antibody; Gasterosteus aculeatus KCNIP3 (2 of 2) antibody G3PYA4 76%
Three-spined stickleback KCNIP4 antibody; Gasterosteus aculeatus KCNIP4 antibody G3Q7G9 78%
Western clawed frog kcnip2 antibody; Xenopus tropicalis kcnip2 antibody F6V1L4 100%
Western clawed frog kcnip3 antibody; Xenopus tropicalis kcnip3 antibody F6QES3 76%
Western clawed frog kcnip3 antibody; Xenopus tropicalis kcnip3 antibody A9UM33 76%
Western clawed frog kcnip4 antibody; Xenopus tropicalis kcnip4 antibody F6V1P2 78%
White-tufted-ear marmoset LOC100392978 antibody; Callithrix jacchus LOC100392978 antibody F7HGX3 100%
White-tufted-ear marmoset LOC100392978 antibody; Callithrix jacchus LOC100392978 antibody F7H166 100%
White-tufted-ear marmoset LOC100392978 antibody; Callithrix jacchus LOC100392978 antibody F7H143 100%
White-tufted-ear marmoset LOC100392978 antibody; Callithrix jacchus LOC100392978 antibody F7DI79 100%
White-tufted-ear marmoset LOC100392978 antibody; Callithrix jacchus LOC100392978 antibody F7D0B2 100%
White-tufted-ear marmoset LOC100411973 antibody; Callithrix jacchus LOC100411973 antibody F7FMG5 78%
White-tufted-ear marmoset LOC100411973 antibody; Callithrix jacchus LOC100411973 antibody F7EUY8 78%
White-tufted-ear marmoset LOC100411973 antibody; Callithrix jacchus LOC100411973 antibody F7EUY1 78%
White-tufted-ear marmoset LOC100411973 antibody; Callithrix jacchus LOC100411973 antibody F7EUP3 78%
Zebra finch KCNIP1 antibody; Taeniopygia guttata KCNIP1 antibody H0ZXB2 78%
Zebra finch KCNIP2 antibody; Taeniopygia guttata KCNIP2 antibody H0ZI33 100%
Zebra finch KCNIP4 antibody; Taeniopygia guttata KCNIP4 antibody H0ZGZ5 78%
Zebrafish kcnip1a antibody; Danio rerio kcnip1a antibody F1R1Z5 85%
Zebrafish kcnip3 antibody; Danio rerio kcnip3 antibody Q6PBP8 76%
Zebrafish kcnip3 antibody; Danio rerio kcnip3 antibody E9QF94 76%
Zebrafish kcnip3 antibody; Danio rerio kcnip3 antibody E7FDK3 76%
Zebrafish kcnip3 antibody; Danio rerio kcnip3 antibody A7MCK1 76%
Zebrafish kcnip3l antibody; Danio rerio kcnip3l antibody Q6PBH8 76%

Product Protocols: KCNIP2 antibody tested with Human Fetal Stomach Tissue (ARP35490_P050)

Aviva Systems Biology is the original manufacturer of this KCNIP2 antibody (ARP35490_P050)

Click here to view the KCNIP2 antibody Western Blot Protocol

Product Datasheet Link: KCNIP2 antibody (ARP35490_P050)

WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Stomach

Western Blot image:

Description of Target: The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s KCNIP2 antibody (ARP35490_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question