website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

Hoxb9 antibody - middle region (ARP31956_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Official Gene Full Name:
Homeo box B9
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express Hoxb9.
Protein Accession #:
Nucleotide Accession#:
Protein Size (# AA):
Molecular Weight:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Hoxb9 antibody - middle region (ARP31956_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%
Species Reactivity:
Human, Rat, Bovine, Dog, Pig, Rabbit, Horse, Mouse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Hoxb9 antibody
- ARP31956_P050
Peptide Sequence:
Synthetic peptide located within the following region: SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
Blocking Peptide:
For anti-Hoxb9 antibody is Catalog # AAP31956 (Previous Catalog # AAPP02853)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Ask a Question