- Description of Target:
- The function of this protein remains unknown.
- Gene Symbol:
- Hoxb9
- Official Gene Full Name:
- Homeo box B9
- Alias Symbols:
- -
- Tissue Tool:
- Find tissues and cell lines supported to express Hoxb9.
- Protein Accession# :
- NP_001093967
- Nucleotide Accession#:
- NM_001100497
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 250
- Molecular Weight:
- 27kDa
- Application:
- WB
- Product Format:
- Lyophilized powder
- Complete computational species homology data:
- Hoxb9 antibody - middle region (ARP31956_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
- Datasheets / Downloads:
- Printable datasheet for
anti-Hoxb9 antibody
- ARP31956_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
- Blocking Peptide:
- For anti-Hoxb9 antibody is Catalog # AAP31956 (Previous Catalog # AAPP02853)
- Key Reference:
- N/A
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-Hoxb9 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
