website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Hoxb9 antibody - middle region (ARP31956_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Hoxb9
Official Gene Full Name:
Homeo box B9
NCBI Gene Id:
287647
Alias Symbols:
-
Tissue Tool:
Find tissues and cell lines supported to express Hoxb9.
Protein Accession #:
NP_001093967
Nucleotide Accession#:
NM_001100497
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
250
Molecular Weight:
27kDa
Application:
WB
Product Format:
Lyophilized powder
Complete computational species homology data:
Hoxb9 antibody - middle region (ARP31956_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%
Species Reactivity:
Human, Rat, Bovine, Dog, Pig, Rabbit, Horse, Mouse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Hoxb9 antibody
- ARP31956_P050
Peptide Sequence:
Synthetic peptide located within the following region: SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
Blocking Peptide:
For anti-Hoxb9 antibody is Catalog # AAP31956 (Previous Catalog # AAPP02853)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Hoxb9 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question