website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

Hoxb9 antibody - middle region (ARP31956_P050)

Description of Target:
The function of this protein remains unknown.
Gene Symbol:
Official Gene Full Name:
Homeo box B9
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express Hoxb9.
Protein Accession #:
Nucleotide Accession#:
Protein Size (# AA):
Molecular Weight:
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
Hoxb9 antibody - middle region (ARP31956_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%
Species Reactivity:
Human, Rat, Bovine, Dog, Pig, Rabbit, Horse, Mouse, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-Hoxb9 antibody
- ARP31956_P050
Peptide Sequence:
Synthetic peptide located within the following region: SEDAPPAKFPSGQYANPRQPGHAEHLDFPSCSFQPKAPVFGASWAPLSPH
Blocking Peptide:
For anti-Hoxb9 antibody is Catalog # AAP31956 (Previous Catalog # AAPP02853)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Hoxb9 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for Hoxb9 antibody (ARP31956)

Product page for Hoxb9 antibody (ARP31956)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant HOXB9 antibody; Loxodonta africana HOXB9 antibody G3TN01 100%
Bovine HOXB9 antibody; Bos taurus HOXB9 antibody E1BIU9 100%
Dog HOXB9 antibody; Canis familiaris HOXB9 antibody E2RQ11 100%
Dog HOXB9 antibody; Canis familiaris HOXB9 antibody E2RPZ8 100%
Gray short-tailed opossum HOXB9 antibody; Monodelphis domestica HOXB9 antibody F7E2Q8 92%
Guinea pig LOC100715121 antibody; Cavia porcellus LOC100715121 antibody H0WDA5 92%
Human HOXB9 antibody; Homo sapiens HOXB9 antibody F8W0V6 100%
Human HOXB9 antibody; Homo sapiens HOXB9 antibody B3KPJ1 100%
Human HXB9 antibody; Homo sapiens HXB9 antibody P17482 100%
Little brown bat HOXB9 antibody; Myotis lucifugus HOXB9 antibody G1PIT4 100%
Mouse Hoxb9 antibody; Mus musculus Hoxb9 antibody Q496Q8 100%
Mouse Hoxb9 antibody; Mus musculus Hoxb9 antibody Q496Q7 100%
Mouse Hoxb9 antibody; Mus musculus Hoxb9 antibody A2A9Z6 100%
Mouse HXB9 antibody; Mus musculus HXB9 antibody P20615 100%
Pig LOC100523635 antibody; Sus scrofa LOC100523635 antibody F1RWG4 100%
Rabbit HOXB9 antibody; Oryctolagus cuniculus HOXB9 antibody G1U843 100%
Rabbit HOXB9 antibody; Oryctolagus cuniculus HOXB9 antibody G1TGG6 100%
Rat Hoxb9 antibody; Rattus norvegicus Hoxb9 antibody D3ZW24 100%
Rhesus macaque HOXB9 antibody; Macaca mulatta HOXB9 antibody F7HN74 100%
Small-eared galago HOXB9 antibody; Otolemur garnettii HOXB9 antibody H0WYZ2 100%
Tammar wallaby HOXB9 antibody; Macropus eugenii HOXB9 antibody G9HPQ8 92%
Tasmanian devil HOXB9 antibody; Sarcophilus harrisii HOXB9 antibody G3WHG0 92%
Ask a Question