website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

COLQ antibody - N-terminal region (ARP34362_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
Gene Symbol:
COLQ
Official Gene Full Name:
Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
NCBI Gene Id:
8292
Alias Symbols:
EAD
Tissue Tool:
Find tissues and cell lines supported to express COLQ.
Protein Accession #:
NP_536805
Nucleotide Accession#:
NM_080544
Swissprot Id:
Q9Y215-8
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Acetylcholinesterase collagenic tail peptide
Protein Size (# AA):
329
Molecular Weight:
34kDa
Application:
WB
Partner Proteins:
ACHE, BCHE, MUSK, BCHE
Immunogen:
The immunogen for anti-COLQ antibody: synthetic peptide directed towards the N terminal of human COLQ
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
COLQ antibody - N-terminal region (ARP34362_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%
Species Reactivity:
Human, Rat, Horse, Rabbit, Mouse, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-COLQ antibody
- ARP34362_P050
Peptide Sequence:
Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF
Blocking Peptide:
For anti-COLQ antibody is Catalog # AAP34362 (Previous Catalog # AAPY00137)
Key Reference:
Ishigaki,K., et al., (2003) Neuromuscul. Disord. 13 (3), 236-244
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-COLQ antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question