website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

COLQ antibody - N-terminal region (ARP34362_P050)

Receive a free positive control (AHL001) when you purchase this antibody. Use the promotion code 'freecontrol' when placing your order.
Please go here for more details.
Description of Target:
COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
Gene Symbol:
Official Gene Full Name:
Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express COLQ.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Acetylcholinesterase collagenic tail peptide
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-COLQ antibody: synthetic peptide directed towards the N terminal of human COLQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
COLQ antibody - N-terminal region (ARP34362_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%
Species Reactivity:
Human, Rat, Horse, Rabbit, Mouse, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-COLQ antibody
- ARP34362_P050
Peptide Sequence:
Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF
Blocking Peptide:
For anti-COLQ antibody is Catalog # AAP34362 (Previous Catalog # AAPY00137)
Target Reference:
Ishigaki,K., et al., (2003) Neuromuscul. Disord. 13 (3), 236-244
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for COLQ antibody (ARP34362)

Product page for COLQ antibody (ARP34362)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant COLQ antibody; Loxodonta africana COLQ antibody G3SXM3 92%
Bovine COLQ antibody; Bos taurus COLQ antibody F1MY98 85%
Bovine COLQ antibody; Bos taurus COLQ antibody E1BPW8 85%
Dog COLQ antibody; Canis familiaris COLQ antibody E2R8I0 92%
Horse COLQ antibody; Equus caballus COLQ antibody F7DDZ2 92%
Horse COLQ antibody; Equus caballus COLQ antibody F7DD81 92%
Human COLQ antibody; Homo sapiens COLQ antibody Q9Y215 100%
Human COLQ antibody; Homo sapiens COLQ antibody Q9Y215-8 100%
Human COLQ antibody; Homo sapiens COLQ antibody Q9Y215-7 100%
Human COLQ antibody; Homo sapiens COLQ antibody Q9Y215-6 100%
Human COLQ antibody; Homo sapiens COLQ antibody Q9Y215-5 100%
Human COLQ antibody; Homo sapiens COLQ antibody Q9Y215-4 100%
Human COLQ antibody; Homo sapiens COLQ antibody Q9Y215-3 100%
Human COLQ antibody; Homo sapiens COLQ antibody C9JBB2 100%
Human COLQ antibody; Homo sapiens COLQ antibody A6NEB3 100%
Little brown bat COLQ antibody; Myotis lucifugus COLQ antibody G1NYL7 92%
Lowland gorilla COLQ antibody; Gorilla gorilla gorilla COLQ antibody G3QP86 100%
Mouse COLQ antibody; Mus musculus COLQ antibody O35348 92%
Rabbit COLQ antibody; Oryctolagus cuniculus COLQ antibody G1TAX2 92%
Rat COLQ antibody; Rattus norvegicus COLQ antibody O35167 92%
Rat COLQ antibody; Rattus norvegicus COLQ antibody O35167-2 92%
Rat Colq antibody; Rattus norvegicus Colq antibody F1M6X2 92%
Rhesus macaque COLQ antibody; Macaca mulatta COLQ antibody F7GP89 92%
Rhesus macaque COLQ antibody; Macaca mulatta COLQ antibody F7GP79 92%
Rhesus macaque COLQ antibody; Macaca mulatta COLQ antibody F7GP68 92%
Rhesus macaque COLQ antibody; Macaca mulatta COLQ antibody F7GP64 92%
Rhesus macaque COLQ antibody; Macaca mulatta COLQ antibody F7GP62 92%
Rhesus macaque COLQ antibody; Macaca mulatta COLQ antibody F7GMS5 92%
Rhesus macaque COLQ antibody; Macaca mulatta COLQ antibody F7GMM4 92%

Product Protocols: COLQ antibody tested with Human Hepg2 Cells (ARP34362_P050)

Aviva Systems Biology is the original manufacturer of this COLQ antibody (ARP34362_P050)

Click here to view the COLQ antibody Western Blot Protocol

Product Datasheet Link: COLQ antibody (ARP34362_P050)

WB Suggested Anti-COLQ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2

Western Blot image:

Description of Target: COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s COLQ antibody (ARP34362_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question