TNRC4 antibody - N-terminal region (ARP31525_P050)

Catalog#: ARP31525_P050

• Size: 50ug

Human Jurkat

• Description of Target: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. While several transcript variants may exist for this gene, the full-length nature of only one has been biologically validated to date.
• Gene Symbol: TNRC4
• Official Gene Full Name: CUGBP, Elav-like family member 3
• Alias Symbols: BRUNOL1; CAGH4; CELF3; ERDA4; MGC57297; TNRC4
• Protein Accession#: NP_009116
• Nucleotide Accession#: NM_007185
• Swissprot Id: Q5SZQ8
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 465
• Molecular Weight: 51kDa
• Application: WB
• Partner Proteins: H3F3A, HES1, GTF2E2, H3F3B, MCM3, MCM4, NEK9, SFRS12, BAZ1B, BRCC3, HIST2H2BE
• Immunogen: The immunogen for anti-TNRC4 antibody: synthetic peptide directed towards the N terminal of human TNRC4
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGC
• Blocking Peptide: For anti-TNRC4 antibody is Catalog # AAP31525 (Previous Catalog # AAPP24092)
• Key Reference: Ladd,A.N., (2001) Mol. Cell. Biol. 21 (4), 1285-1296
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-TNRC4 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: TNRC4 antibody tested with Human Jurkat Cells (ARP31525_P050)

Aviva Systems Biology is the original manufacturer of this TNRC4 antibody (ARP31525_P050)

Click here to view the TNRC4 antibody Western Blot Protocol

Product Datasheet Link: TNRC4 antibody (ARP31525_P050)

WB Suggested Anti-TNRC4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat

Western Blot image:


Description of Target: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. While several transcript variants may exist for this gene, the full-length nature of only one has been biologically validated to date.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TNRC4 antibody (ARP31525_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com