TBR1 antibody - middle region (ARP31497_P050)

Catalog#: ARP31497_P050

• Size: 50ug

Human Brain lysate

• Description of Target: This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase.This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase.
• Gene Symbol: TBR1
• Official Gene Full Name: T-box, brain, 1
• Alias Symbols: MGC141978; TES-56; TBR-1
• Protein Accession#: NP_006584
• Nucleotide Accession#: NM_006593
• Swissprot Id: Q16650
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 682
• Molecular Weight: 74kDa
• Application: WB
• Partner Proteins: TOPBP1
• Immunogen: The immunogen for anti-TBR1 antibody: synthetic peptide directed towards the middle region of human TBR1
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Dog: 100%; Human: 100%; Pig: 100%; Mouse: 85%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: MAGANPYLGEEAEGLAAERSPLPPGAAEDAKPKDLSDSSWIETPSSIKSI
• Blocking Peptide: For anti-TBR1 antibody is Catalog # AAP31497 (Previous Catalog # AAPP02259)
• Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-TBR1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: TBR1 antibody tested with Human Fetal Brain Tissue (ARP31497_P050)

Aviva Systems Biology is the original manufacturer of this TBR1 antibody (ARP31497_P050)

Click here to view the TBR1 antibody Western Blot Protocol

Product Datasheet Link: TBR1 antibody (ARP31497_P050)

WB Suggested Anti-TBR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Brain

Western Blot image:


Description of Target: This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase.This gene is a member of a conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similar protein has been disrupted in mice and shown to be critical for early cortical development, and causes loss of projection neurons in the olfactory bulbs and olfactory cortex. The C-terminal region this similar protein was found to be necessary and sufficient for association with the guanylate kinase domain of calcium/calmodulin-dependent serine protein kinase.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s TBR1 antibody (ARP31497_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com