SEMA4D antibody - N-terminal region (ARP61493_P050)

Catalog#: ARP61493_P050

• Size: 50ug

Human HeLa

• Description of Target: SEMA4D may play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.
• Gene Symbol: SEMA4D
• Official Gene Full Name: Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4D
• Alias Symbols: C9orf164; CD100; FLJ33485; FLJ34282; FLJ39737; FLJ46484; M-sema-G; MGC169138; MGC169141; SEMAJ; coll-4
• Protein Accession#: NP_001135759
• Nucleotide Accession#: NM_001142287
• Swissprot Id: Q92854-2
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 738
• Molecular Weight: 81kDa
• Application: WB
• Partner Proteins: CD72, PLXNB1, PTPRC, SEMA4D, CD72, PLXNB1, PTPRC, SEMA4D
• Product Format: Lyophilized powder
• Predicted Homology Based on Immunogen Sequence: Guinea pig: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Bovine: 92%; Dog: 92%; Mouse: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: SEDKKAKCAEKGKSKQTECLNYIRVLQPLSATSLYVCGTNAFQPACDHLN
• Blocking Peptide: For anti-SEMA4D antibody is Catalog # AAP61493 (Previous Catalog # AAPP47848)
• Key Reference: N/A
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-SEMA4D antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.