NEUROD1 antibody - N-terminal region (ARP32036_T100)

Catalog#: ARP32036_T100

• Size: 100ug

Human Jurkat

• Description of Target: NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation.
• Gene Symbol: NEUROD1
• Official Gene Full Name: Neuronal differentiation 1
• Alias Symbols: BETA2; BHF-1; MODY6; NEUROD; bHLHa3
• Protein Accession#: NP_002491
• Nucleotide Accession#: NM_002500
• Swissprot Id: Q13562
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 356
• Molecular Weight: 40kDa
• Application: WB
• Partner Proteins: PKN1, PKN1
• Immunogen: The immunogen for anti-NEUROD1 antibody: synthetic peptide directed towards the N terminal of human NEUROD1
• Product Format: Lyophilized powder
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Dog: 92%; Pig: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE
• Blocking Peptide: For anti-NEUROD1 antibody is Catalog # AAP32036 (Previous Catalog # AAPP02938)
• Key Reference: Peng,S.Y., et al., (2005) Biochim. Biophys. Acta 1731 (3), 154-159
• Reconstitution and Storage: Add 100 μl of distilled water. Final anti-NEUROD1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: NEUROD1 antibody tested with Human Jurkat Cells (ARP32036_T100)

Aviva Systems Biology is the original manufacturer of this NEUROD1 antibody (ARP32036_T100)

Click here to view the NEUROD1 antibody Western Blot Protocol

Product Datasheet Link: NEUROD1 antibody (ARP32036_T100)

WB Suggested Anti-NEUROD1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat

Western Blot image:


Description of Target: NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s NEUROD1 antibody (ARP32036_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com