KCNIP2 antibody - middle region (ARP35490_P050)

Catalog#: ARP35490_P050

• Size: 50ug

Human Stomach

• Description of Target: The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.
• Gene Symbol: KCNIP2
• Official Gene Full Name: Kv channel interacting protein 2
• Alias Symbols: DKFZp566L1246; KCHIP2; MGC17241
• Protein Accession#: NP_775283
• Nucleotide Accession#: NM_173191
• Swissprot Id: Q9NS61
• Host: Rabbit
• Clonality: Polyclonal
• Protein Size (# AA): 270
• Molecular Weight: 31kDa
• Application: WB
• Partner Proteins: KCND2, KCND3, KCNIP4
• Immunogen: The immunogen for anti-KCNIP2 antibody: synthetic peptide directed towards the middle region of human KCNIP2
• Product Format: Lyophilized powder
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 78%
• Peptide Sequence: Synthetic peptide located within the following region: LQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSTYATFLFNAFDTNH
• Blocking Peptide: For anti-KCNIP2 antibody is Catalog # AAP35490 (Previous Catalog # AAPP07285)
• Key Reference: Han,W., (2006) J. Biol. Chem. 281 (37), 27134-27144
• Reconstitution and Storage: Add 50 μl of distilled water. Final anti-KCNIP2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Product Protocols: KCNIP2 antibody tested with Human Fetal Stomach Tissue (ARP35490_P050)

Aviva Systems Biology is the original manufacturer of this KCNIP2 antibody (ARP35490_P050)

Click here to view the KCNIP2 antibody Western Blot Protocol

Product Datasheet Link: KCNIP2 antibody (ARP35490_P050)

WB Suggested Anti-KCNIP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Stomach

Western Blot image:


Description of Target: The KCNIP2 gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s KCNIP2 antibody (ARP35490_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com