- Description of Target:
- DLX5 is a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This protein may play a role in bone development and fracture healing. Mutation in its gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
- Gene Symbol:
- DLX5
- Official Gene Full Name:
- Distal-less homeobox 5
- Alias Symbols:
- SHFM1D
- Tissue Tool:
- Find tissues and cell lines supported to express DLX5.

- Protein Accession# :
- NP_005212
- Nucleotide Accession#:
- NM_005221
- Swissprot Id:
- P56178
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 289
- Molecular Weight:
- 32kDa
- Application:
- WB
- Partner Proteins:
- SLC9A3R1, SLC9A3R2
- Immunogen:
- The immunogen for anti-DLX5 antibody: synthetic peptide directed towards the N terminal of human DLX5
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- DLX5 antibody - N-terminal region (ARP31607_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; African clawed frog: 78%
- Datasheets / Downloads:
- Printable datasheet for
anti-DLX5 antibody
- ARP31607_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: NPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK
- Blocking Peptide:
- For anti-DLX5 antibody is Catalog # AAP31607 (Previous Catalog # AAPP02388)
- Key Reference:
- Kato,T., (2008) Clin. Cancer Res. 14 (8), 2363-2370
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-DLX5 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: DLX5 antibody tested with Human Thp-1 Cells (ARP31607_P050)
Aviva Systems Biology is the original manufacturer of this DLX5 antibody (ARP31607_P050)
Click here to view the DLX5 antibody Western Blot Protocol
Product Datasheet Link: DLX5 antibody (ARP31607_P050)
WB Suggested Anti-DLX5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: THP-1
Western Blot image: 
Description of Target: DLX5 is a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This protein may play a role in bone development and fracture healing. Mutation in its gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s DLX5 antibody (ARP31607_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


