- Description of Target:
- Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.
- Gene Symbol:
- DLX2
- Official Gene Full Name:
- Distal-less homeobox 2
- Alias Symbols:
- TES1; TES-1
- Tissue Tool:
- Find tissues and cell lines supported to express DLX2.
- Protein Accession# :
- NP_004396
- Nucleotide Accession#:
- NM_004405
- Swissprot Id:
- Q07687
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 328
- Molecular Weight:
- 34kDa
- Application:
- WB, IHC
- Partner Proteins:
- PRKCA
- Immunogen:
- The immunogen for anti-DLX2 antibody: synthetic peptide directed towards the N terminal of human DLX2
- Product Format:
- Lyophilized powder
- Purification:
- Protein A purified
- Complete computational species homology data:
- DLX2 antibody - N-terminal region (ARP31604_T100)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Mouse: 92%; Bovine: 86%
- Datasheets / Downloads:
- Printable datasheet for
anti-DLX2 antibody
- ARP31604_T100 - Peptide Sequence:
- Synthetic peptide located within the following region: MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP
- Blocking Peptide:
- For anti-DLX2 antibody is Catalog # AAP31604 (Previous Catalog # AAPP02385)
- Key Reference:
- McGuinness,T., et al., (1996) Genomics 35 (3), 473-485
- Reconstitution and Storage:
- Add 100 μl of distilled water. Final anti-DLX2 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: DLX2 antibody tested with Human Jurkat Cells (ARP31604_T100)
Aviva Systems Biology is the original manufacturer of this DLX2 antibody (ARP31604_T100)
Click here to view the DLX2 antibody Western Blot Protocol
Product Datasheet Link: DLX2 antibody (ARP31604_T100)
WB Suggested Anti-DLX2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat
Western Blot image: 
Description of Target: Many vertebrate homeo box-containing genes have been identified on the basis of their sequence similarity with Drosophila developmental genes. Members of the Dlx gene family contain a homeobox that is related to that of Distal-less (Dll), a gene expressed in the head and limbs of the developing fruit fly. The Distal-less (Dlx) family of genes comprises at least 6 different members, DLX1-DLX6. The DLX proteins are postulated to play a role in forebrain and craniofacial development.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s DLX2 antibody (ARP31604_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
Product Protocols: DLX2 antibody tested by IHC with human muscle (ARP31604)
Aviva Systems Biology is the original manufacturer of this DLX2 antibody.
Click here to view the DLX2 antibody Immunohistochemistry (IHC) protocol
Product Datasheet Link: DLX2 antibody (ARP31604)
IHC Information:
Rabbit Anti-DLX2 Antibody
Catalog Number: ARP31604
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
IHC Image:
Product Review: DLX2 antibody-N-terminal region (ARP31604_T100) in Mouse WT brain and Rat brain using Western blot
Product Page for DLX2 antibody - N-terminal region (ARP31604_T100)
Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Application: Western blotting
Species+tissue/cell type: Mouse WT brain and Rat brain
How many ug’s of tissue/cell lysate run on the gel: 1. Mouse WT brain extract (80ug) 2. Rat brain extract (80ug)
Primary antibody dilution: 2ug/ml
Secondary antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary antibody dilution: 1: 20,000
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
