- Description of Target:
- COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
- Gene Symbol:
- COLQ
- Official Gene Full Name:
- Collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
- Alias Symbols:
- EAD
- Tissue Tool:
- Find tissues and cell lines supported to express COLQ.
- Protein Accession# :
- NP_536805
- Nucleotide Accession#:
- NM_080544
- Swissprot Id:
- Q9Y215-8
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 329
- Molecular Weight:
- 34kDa
- Application:
- WB
- Partner Proteins:
- ACHE, BCHE, MUSK, BCHE
- Immunogen:
- The immunogen for anti-COLQ antibody: synthetic peptide directed towards the N terminal of human COLQ
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- COLQ antibody - N-terminal region (ARP34362_P050)
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Bovine: 85%
- Datasheets / Downloads:
- Printable datasheet for
anti-COLQ antibody
- ARP34362_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF
- Blocking Peptide:
- For anti-COLQ antibody is Catalog # AAP34362 (Previous Catalog # AAPY00137)
- Key Reference:
- Ishigaki,K., et al., (2003) Neuromuscul. Disord. 13 (3), 236-244
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-COLQ antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: COLQ antibody tested with Human Hepg2 Cells (ARP34362_P050)
Aviva Systems Biology is the original manufacturer of this COLQ antibody (ARP34362_P050)
Click here to view the COLQ antibody Western Blot Protocol
Product Datasheet Link: COLQ antibody (ARP34362_P050)
WB Suggested Anti-COLQ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2
Western Blot image: 
Description of Target: COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s COLQ antibody (ARP34362_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.
TO ORDER：
Tel:(888) 880-0001
Fax:(858) 552-6975
